DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and Npbwr1

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_034472.1 Gene:Npbwr1 / 226304 MGIID:891989 Length:329 Species:Mus musculus


Alignment Length:349 Identity:82/349 - (23%)
Similarity:146/349 - (41%) Gaps:72/349 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRWAFG 132
            |:|..:..:|:.||..|.||:||...|:||||:||.|||::|.|. .|.:|.......:.||.||
Mouse    44 VVYGVICAVGLAGNSAVLYVLLRTPRMKTVTNVFILNLAIADELF-TLVLPINIADFLLRRWPFG 107

  Fly   133 RSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIG----IIVSIWVIALLAT 193
            ..:|.|:......:.:.|...|..::.|||.|::.....|.......|    :.:::|.:..|..
Mouse   108 EVMCKLIVAVDQYNTFSSLYFLAVMSADRYLVVLATAESRRVSGRTYGAARAVSLAVWALVTLVV 172

  Fly   194 VPYGMYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMTAGSTG 258
            :|:.::.::..|                         ||                          
Mouse   173 LPFAVFARLDEE-------------------------QG-------------------------- 186

  Fly   259 PEMPYVRVYCEENWPSEQ--YRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRARAKPGSKSS 321
                  |..|...:|..:  :.:.....|..|.|.:|  :.:||.::.::....||.    ...|
Mouse   187 ------RRQCVLVFPQPEAFWWRASRLYTLVLGFAIP--VTTICALYTTLLCRLRAI----QLDS 239

  Fly   322 RREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDFDDKSNEWRFYILFFFVAHSIAMSST 386
            ..:..|| .|||...::.|::||..|.|.|.::..|.....|.........:.:|:. |::.:::
Mouse   240 HAKALDR-AKKRVTLLVAAILAVCLLCWTPYHLSTIVALTTDLPQTPLVIGISYFIT-SLSYANS 302

  Fly   387 CYNPFLYAWLNENFRKEFKHVLPC 410
            |.||||||:|:::||:..:.::.|
Mouse   303 CLNPFLYAFLDDSFRRSLRQLVSC 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 38/124 (31%)
7tm_1 80..393 CDD:278431 72/318 (23%)
Npbwr1NP_034472.1 7tm_1 56..309 CDD:278431 72/318 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.