DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and Npy4r

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_032945.3 Gene:Npy4r / 19065 MGIID:105374 Length:375 Species:Mus musculus


Alignment Length:349 Identity:105/349 - (30%)
Similarity:166/349 - (47%) Gaps:54/349 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 FFYVLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFMGRW 129
            |....|:...:|||.||:.:.:|..|.:....|||:.|.|||.||.|:|::..|.|..||.|..|
Mouse    43 FIITTYSIETILGVLGNLCLIFVTTRQKEKSNVTNLLIANLAFSDFLMCLICQPLTVTYTIMDYW 107

  Fly   130 AFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYP--FHPRMKLSTCIGIIVSIWVIALLA 192
            .||..||.:::|.|..|:.:|.|:|..:|::|:.:||.|  :.|.: ....:||:| ||.::...
Mouse   108 IFGEVLCKMLTFIQCMSVTVSILSLVLVALERHQLIINPTGWKPSI-FQAYLGIVV-IWFVSCFL 170

  Fly   193 TVPYGMYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMTAGST 257
            ::|:         |.|.|             ||..|....|..:|..:.                
Mouse   171 SLPF---------LANST-------------LNDLFHYNHSKVVEFLED---------------- 197

  Fly   258 GPEMPYVRVYCEENWPSEQYRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRARAKPGSKSSR 322
                   :|.|..:|.|:.:|.::.......|:.:|...|.:||:.|..:|.::.........|.
Mouse   198 -------KVVCFVSWSSDHHRLIYTTFLLLFQYCIPLAFILVCYIRIYQRLQRQKHVFHAHACSS 255

  Fly   323 REEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDFDDKSNEWRFYILFFFVAHSIAMSSTC 387
            |    ..:.||.|.||:.||..|.:.|||::|.|..:|:..::.......|.|.:.|.:||:|||
Mouse   256 R----AGQMKRINSMLMTMVTAFAVLWLPLHVFNTLEDWYQEAIPACHGNLIFLMCHLLAMASTC 316

  Fly   388 YNPFLYAWLNENFRKEFKH-VLPC 410
            .|||:|.:||.||:|:.|. ||.|
Mouse   317 VNPFIYGFLNINFKKDIKALVLTC 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 45/122 (37%)
7tm_1 80..393 CDD:278431 90/314 (29%)
Npy4rNP_032945.3 7tm_4 52..>174 CDD:304433 45/123 (37%)
7tm_1 58..322 CDD:278431 90/314 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24235
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.