DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and Fpr-rs3

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_032066.2 Gene:Fpr-rs3 / 14290 MGIID:1278318 Length:343 Species:Mus musculus


Alignment Length:365 Identity:87/365 - (23%)
Similarity:145/365 - (39%) Gaps:99/365 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IFFYVLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLY----T 124
            |...::.:..|||||.||.||.:|. ..|...|||.|...||||.|....|.    .||:    .
Mouse    27 ILSVIVLSITFVLGVLGNGLVIWVA-GFRMAHTVTTICYLNLALGDFSFMVT----LPLHIISMV 86

  Fly   125 FMGRWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPF----HPRMKLSTCIGIIVSI 185
            ..|:|.||..||..|......::::|...:|.||:||...:::|.    |..:.|:.  .:||..
Mouse    87 MKGKWLFGWFLCKFVLSIVHINLFVSVFLITLIAMDRCTCVLHPVWVQNHRTVSLAR--KVIVGA 149

  Fly   186 WVIALLATVPYGMYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQ 250
            |:::||.|:|:.:::....:                        |:|                  
Mouse   150 WILSLLLTLPHFLFLTTVRD------------------------ARG------------------ 172

  Fly   251 VMTAGSTGPEMPYVRVYCEENW------PSEQYR------KVFGAITTTLQFVLPFFIISICYVW 303
                          .|:|..|:      |.||.:      ...|.|:..:.|.||...|::||..
Mouse   173 --------------EVHCTCNFESVVANPEEQLKVSITVSTATGIISFIIGFSLPMSFIAVCYGL 223

  Fly   304 ISVKLNQRARAKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDFDDKSNEW 368
            ::.|:     .:.|..:|          .|..|:|.|:...|.:.|.|..::.:..:..:|....
Mouse   224 MAAKI-----CRKGFLNS----------SRPLRVLTAVAISFFMCWFPFQLIILLGNIWNKETPS 273

  Fly   369 RFYILFFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVL 408
            ..:|| ...|.::|..::|.||.||.:|.:.||::..:.|
Mouse   274 SIHIL-LNPASTLASFNSCLNPILYVFLGQEFREKLIYSL 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 44/128 (34%)
7tm_1 80..393 CDD:278431 75/332 (23%)
Fpr-rs3NP_032066.2 7tm_1 43..297 CDD:278431 75/332 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.