DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and Fpr2

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_032065.1 Gene:Fpr2 / 14289 MGIID:1278319 Length:351 Species:Mus musculus


Alignment Length:367 Identity:96/367 - (26%)
Similarity:148/367 - (40%) Gaps:96/367 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IFFYVLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVPFTPLYTFM-G 127
            |...|:.:..|.|||.||.||.:|. ..|...|||.|:..||||:|... ...:||..:...| .
Mouse    27 ILSMVVVSITFFLGVLGNGLVIWVA-GFRMPHTVTTIWYLNLALADFSF-TATLPFLLVEMAMKE 89

  Fly   128 RWAFGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPF----HPRMKLSTCIGIIVSIWVI 188
            :|.||..||.||......:::.|...:..||:||...:::|.    |..:.|:.  .::|..|:.
Mouse    90 KWPFGWFLCKLVHIVVDVNLFGSVFLIALIALDRCICVLHPVWAQNHRTVSLAR--KVVVGPWIF 152

  Fly   189 ALLATVPYGMYMKMTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMT 253
            ||:.|:|..:::                                                     
Mouse   153 ALILTLPIFIFL----------------------------------------------------- 164

  Fly   254 AGSTGPEMPYVRVYCEEN---WPSEQYRKVFGAIT--TT-------LQFVLPFFIISICYVWISV 306
               |...:|...|||..|   |......|:..|||  ||       :.|.:|..|:::||..|:|
Mouse   165 ---TTVRIPGGDVYCTFNFGSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAV 226

  Fly   307 KLNQRARAKPGSKSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDD--FDDKSNEWR 369
            |:|:|               :.....|..|:|.|:||.|.:.|.|..:|.:...  |.:......
Mouse   227 KINRR---------------NLVNSSRPLRVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGS 276

  Fly   370 FYILFFFV--AHSIAMSSTCYNPFLYAWLNENFRKEFKHVLP 409
            :.||..||  ..|:|..::|.||.||.::.::||:.|.|.||
Mouse   277 YKILDMFVNPTSSLAYFNSCLNPMLYVFMGQDFRERFIHSLP 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 41/125 (33%)
7tm_1 80..393 CDD:278431 82/333 (25%)
Fpr2NP_032065.1 7tm_1 43..302 CDD:278431 82/333 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 325..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.