DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and C5ar1

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001167021.1 Gene:C5ar1 / 12273 MGIID:88232 Length:351 Species:Mus musculus


Alignment Length:361 Identity:81/361 - (22%)
Similarity:135/361 - (37%) Gaps:104/361 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 VLYATVFVLGVFGNVLVCYVVLRNRAMQTVTNIFITNLALSDILLCVLAVP--FTPLYTFMGRWA 130
            ::|:.||::||.||.||.:|. ...|.:.|..|:..|||::|:|.| ||:|  ||.:... ..|.
Mouse    42 IIYSVVFLVGVPGNALVVWVT-AFEARRAVNAIWFLNLAVADLLSC-LALPVLFTTVLNH-NYWY 103

  Fly   131 FGRSLCHLVSFAQGCSIYISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVS--IWVIALLAT 193
            |..:.|.::......::|.|.|.|.:|:.||:.::..|...:....|.:..:..  .||:|||.|
Mouse   104 FDATACIVLPSLILLNMYASILLLATISADRFLLVFKPIWCQKVRGTGLAWMACGVAWVLALLLT 168

  Fly   194 VPYGMYMK-----MTNELVNGTQTGNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMT 253
            :|..:|.:     .:...|.|...|           .|||                         
Mouse   169 IPSFVYREAYKDFYSEHTVCGINYG-----------GGSF------------------------- 197

  Fly   254 AGSTGPEMPYVRVYCEENWPSEQYRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRARAKPGS 318
                               |.|   |....:...:.||||...::|||.::.::...|...    
Mouse   198 -------------------PKE---KAVAILRLMVGFVLPLLTLNICYTFLLLRTWSRKAT---- 236

  Fly   319 KSSRREEADRDRKKRTNRMLIAMVAVFGLSWLPINVVNIFDDF----------DDKSNEWRFYIL 373
                       |..:|.::::|:|..|.:.|||..|..:...:          .:|.|.      
Mouse   237 -----------RSTKTLKVVMAVVICFFIFWLPYQVTGVMIAWLPPSSPTLKRVEKLNS------ 284

  Fly   374 FFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKHVLP 409
               :..|:|..:.|.||.:|....:.|.......||
Mouse   285 ---LCVSLAYINCCVNPIIYVMAGQGFHGRLLRSLP 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 39/124 (31%)
7tm_1 80..393 CDD:278431 72/331 (22%)
C5ar1NP_001167021.1 7tm_1 54..301 CDD:278431 72/331 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 329..351
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.