DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sNPF-R and LOC100536630

DIOPT Version :9

Sequence 1:NP_001262086.1 Gene:sNPF-R / 40195 FlyBaseID:FBgn0036934 Length:600 Species:Drosophila melanogaster
Sequence 2:XP_021326648.1 Gene:LOC100536630 / 100536630 -ID:- Length:218 Species:Danio rerio


Alignment Length:274 Identity:72/274 - (26%)
Similarity:117/274 - (42%) Gaps:70/274 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   148 YISTLTLTSIAIDRYFVIIYPFHPRMKLSTCIGIIVSIWVIALLATVPYGMYMKMTNELVNGTQT 212
            |:|:.        ||:..::|...|:.::.|..::..||:::.:...|                 
Zfish     2 YVSSC--------RYYATVHPLKKRISMAACAYVLSGIWLLSCVLVAP----------------- 41

  Fly   213 GNETLVEATLMLNGSFVAQGSGFIEAPDSTSATQAYMQVMTAGSTGPEMPYVRVYCEENW-PSEQ 276
                                         ..|...:::....|.|         .|||.| ..|.
Zfish    42 -----------------------------AVAHTYHVEFKDEGLT---------ICEEFWLGQET 68

  Fly   277 YRKVFGAITTTLQFVLPFFIISICYVWISVKLNQRARAKPGSKSSRREEADRDRKKRTNRMLIAM 341
            .|.|:...|..|.::||...:.:.|:.|||||  |....||.::..:.||.|.||::..|::..:
Zfish    69 QRLVYAYSTLLLTYILPLSAVCVSYLCISVKL--RNCVAPGHRTRDQAEAQRIRKRKIFRLVSLV 131

  Fly   342 VAVFGLSWLPINVVNIFDDFDDKSNEWRFYILFFFVAHSIAMSSTCYNPFLYAWLNENFRKEFKH 406
            ||.|.:.||||:|.|:..|.|.:....|.::|...:.|..||||:|.||||||||::.||.|.:.
Zfish   132 VAAFAVCWLPIHVFNVLRDIDIRLINKRHFLLIQLLCHLCAMSSSCCNPFLYAWLHDRFRAELRK 196

  Fly   407 VLPCFN----PSNN 416
            :..|..    |:|:
Zfish   197 MFTCHRRIGIPANH 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
sNPF-RNP_001262086.1 7tm_4 75..>196 CDD:304433 9/47 (19%)
7tm_1 80..393 CDD:278431 61/245 (25%)
LOC100536630XP_021326648.1 7tm_GPCRs <7..194 CDD:333717 66/243 (27%)
TM helix 4 26..42 CDD:320095 3/61 (5%)
TM helix 5 71..94 CDD:320095 5/22 (23%)
TM helix 6 122..147 CDD:320095 9/24 (38%)
TM helix 7 162..187 CDD:320095 14/24 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1072979at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.