DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14184 and Lamtor1

DIOPT Version :9

Sequence 1:NP_001189136.1 Gene:CG14184 / 40193 FlyBaseID:FBgn0036932 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_079881.2 Gene:Lamtor1 / 66508 MGIID:1913758 Length:161 Species:Mus musculus


Alignment Length:166 Identity:57/166 - (34%)
Similarity:82/166 - (49%) Gaps:13/166 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CTEDPGAQPNEPNERTHLLVDPVNHSP--ALRRSNSDGLSTDYAHSLP--KKDDQNALSRLVQNT 80
            |........::..|...||:|| :.:|  ||     :|...:| ||||  :.|:|..||.::..|
Mouse     4 CYSSENEDSDQDREERKLLLDP-SSTPTKAL-----NGAEPNY-HSLPSARTDEQALLSSILAKT 61

  Fly    81 AINMINVGAMDCHSLEHQEYADRIRLYSQRLHQQWNNGQH-ASIAPKGLLKDVPSHQFYLSKPTY 144
            |.|:|:|.|.|...:|..||.||.|.||.||....::..| ..:.|...|...| ||...|:|..
Mouse    62 ASNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQP-HQVLASEPIP 125

  Fly   145 PDDTAQMKLFTEKAHISVSHIQIDHKEAVVVPFRIP 180
            ..|..|:......|:.::|.|::|.||.:||.|.||
Mouse   126 FSDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14184NP_001189136.1 LAMTOR 33..104 CDD:292094 29/74 (39%)
Lamtor1NP_079881.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43 12/45 (27%)
LAMTOR 21..85 CDD:373860 28/70 (40%)
Interaction with LAMTOR2 and LAMTOR3. /evidence=ECO:0000250 121..161 13/39 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842483
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CD5E
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5288
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49940
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008265
OrthoInspector 1 1.000 - - oto92512
orthoMCL 1 0.900 - - OOG6_107182
Panther 1 1.100 - - LDO PTHR13401
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5697
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.790

Return to query results.
Submit another query.