DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14184 and lamtor1

DIOPT Version :9

Sequence 1:NP_001189136.1 Gene:CG14184 / 40193 FlyBaseID:FBgn0036932 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_989303.1 Gene:lamtor1 / 394922 XenbaseID:XB-GENE-5879626 Length:162 Species:Xenopus tropicalis


Alignment Length:171 Identity:55/171 - (32%)
Similarity:79/171 - (46%) Gaps:19/171 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 CWQCTEDPGAQPNEPNERTHLLVDPVNHS-PALRRSNSDGLSTDYAHSLPKKDDQNALSRLVQNT 80
            |:....|.|  ..:..||.|||  |.:.| |....:.|:..||:  :...:.|:|..|||::..|
 Frog     4 CYSGETDTG--KGDQGEREHLL--PQSQSLPNKAPNESEQNSTN--NPSARTDEQAMLSRILAKT 62

  Fly    81 AINMINVGAMDCHSLEHQEYADRIRLYSQRLHQ------QWNNGQHASIAPKGLLKDVPSHQFYL 139
            |.|:|:|.|::...:|..|..||.|.||.||.:      .|.     .:.|...|...| ||...
 Frog    63 AQNIIDVSAVESQGMEQHECMDRARQYSTRLAKLSSNLMDWK-----KVPPLPSLTSQP-HQILA 121

  Fly   140 SKPTYPDDTAQMKLFTEKAHISVSHIQIDHKEAVVVPFRIP 180
            |.|....|..|:......|..::|.|::|.||.:||.|.||
 Frog   122 SDPVPFADIQQVSKIAAYAFSALSQIRVDAKEDLVVQFGIP 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14184NP_001189136.1 LAMTOR 33..104 CDD:292094 25/71 (35%)
lamtor1NP_989303.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 16/55 (29%)
LAMTOR 22..86 CDD:373860 22/67 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 63 1.000 Inparanoid score I5198
OMA 1 1.010 - - QHG49940
OrthoDB 1 1.010 - - D1420294at2759
OrthoFinder 1 1.000 - - FOG0008265
OrthoInspector 1 1.000 - - oto102814
Panther 1 1.100 - - LDO PTHR13401
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5697
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.110

Return to query results.
Submit another query.