DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14184 and LOC100361543

DIOPT Version :9

Sequence 1:NP_001189136.1 Gene:CG14184 / 40193 FlyBaseID:FBgn0036932 Length:180 Species:Drosophila melanogaster
Sequence 2:XP_002730282.1 Gene:LOC100361543 / 100361543 RGDID:2319924 Length:161 Species:Rattus norvegicus


Alignment Length:165 Identity:57/165 - (34%)
Similarity:80/165 - (48%) Gaps:11/165 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 CTEDPGAQPNEPNERTHLLVDPVN-HSPALRRSNSDGLSTDYAHSLP--KKDDQNALSRLVQNTA 81
            |........::..|...||:||.| .:.||     :|....| ||||  :.|:|..||.::..||
  Rat     4 CYSSENEDSDQDQEERKLLLDPSNTPTKAL-----NGAEPSY-HSLPSARTDEQALLSSILAKTA 62

  Fly    82 INMINVGAMDCHSLEHQEYADRIRLYSQRLHQQWNNGQH-ASIAPKGLLKDVPSHQFYLSKPTYP 145
            .|:|:|.|.|...:|..||.||.|.||.||....::..| ..:.|...|...| ||...|:|...
  Rat    63 SNIIDVSAADSQGMEQHEYMDRARQYSTRLAVLSSSLTHWKKLPPLPSLTSQP-HQVLASEPIPF 126

  Fly   146 DDTAQMKLFTEKAHISVSHIQIDHKEAVVVPFRIP 180
            .|..|:......|:.::|.|::|.||.:||.|.||
  Rat   127 SDLQQVSRIAAYAYSALSQIRVDAKEELVVQFGIP 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14184NP_001189136.1 LAMTOR 33..104 CDD:292094 29/73 (40%)
LOC100361543XP_002730282.1 LAMTOR 21..85 CDD:406019 28/69 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12203
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 73 1.000 Inparanoid score I5196
OMA 1 1.010 - - QHG49940
OrthoDB 1 1.010 - - D1420294at2759
OrthoFinder 1 1.000 - - FOG0008265
OrthoInspector 1 1.000 - - oto96079
orthoMCL 1 0.900 - - OOG6_107182
Panther 1 1.100 - - LDO PTHR13401
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
109.980

Return to query results.
Submit another query.