DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14184 and lamtor1

DIOPT Version :9

Sequence 1:NP_001189136.1 Gene:CG14184 / 40193 FlyBaseID:FBgn0036932 Length:180 Species:Drosophila melanogaster
Sequence 2:NP_001269069.1 Gene:lamtor1 / 100329656 ZFINID:ZDB-GENE-130819-1 Length:160 Species:Danio rerio


Alignment Length:162 Identity:49/162 - (30%)
Similarity:73/162 - (45%) Gaps:14/162 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 TEDPGAQPNEPNERTHLLVDPVNHSPALRRS--NSDGLSTDYAHSLPKKDDQNALSRLVQNTAIN 83
            |.||.....:|     |:.||.........|  |:|.|.::      :.|:|..|:.::|.||:|
Zfish    11 TTDPDGDEVKP-----LIPDPNQERKPTNGSERNADNLPSN------RTDEQALLTVILQRTALN 64

  Fly    84 MINVGAMDCHSLEHQEYADRIRLYSQRLHQQWNNGQHASIAPKGLLKDVPSHQFYLSKPTYPDDT 148
            :|:|.|:|...:|..||.||.|.||.:|.............|...|...| ||...:......|.
Zfish    65 IIDVSAVDSQGMEQHEYMDRARQYSTKLEVLSRTLSQKKPVPLPSLTSQP-HQVLAADLVPHADV 128

  Fly   149 AQMKLFTEKAHISVSHIQIDHKEAVVVPFRIP 180
            .|:......|:.::|.|::|.||.:||.|.||
Zfish   129 QQVSKIAAYAYSAISQIKVDAKEELVVQFAIP 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14184NP_001189136.1 LAMTOR 33..104 CDD:292094 22/72 (31%)
lamtor1NP_001269069.1 LAMTOR 18..85 CDD:292094 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170586913
Domainoid 1 1.000 42 1.000 Domainoid score I12479
eggNOG 1 0.900 - - E1_2CD5E
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 66 1.000 Inparanoid score I5358
OMA 1 1.010 - - QHG49940
OrthoDB 1 1.010 - - D1420294at2759
OrthoFinder 1 1.000 - - FOG0008265
OrthoInspector 1 1.000 - - oto41219
orthoMCL 1 0.900 - - OOG6_107182
Panther 1 1.100 - - LDO PTHR13401
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5697
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.