DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and PEX6

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_014070.1 Gene:PEX6 / 855387 SGDID:S000005273 Length:1030 Species:Saccharomyces cerevisiae


Alignment Length:352 Identity:64/352 - (18%)
Similarity:125/352 - (35%) Gaps:80/352 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   553 YNELKDAGIIEEIGHRDFDEFIT--DFNFVADDTRDEDGLTTLGP---------------AKGDI 600
            |.|.|..|.:.:      ...||  |.:......|:|..::...|               .||:|
Yeast   686 YQESKKCGWLPQ------SILITQEDLSKATSKARNEFSVSIGAPQIPNVTWDDIGGIDFVKGEI 744

  Fly   601 KMVIQESMLGMGEFDVP------------KPKSLLLIGPLNSGKRLLCEIIASELDAVFMNL-SP 652
                      :...|:|            |...:|..||..:||.|:.:.||:.....|.:: .|
Yeast   745 ----------LDTIDMPLKHPELFTSGMKKRSGILFYGPPGTGKTLMAKAIATNFSLNFFSVKGP 799

  Fly   653 ENTYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPRLLGTSLASKILKP 717
            |....|..:.:..:..:.:.|:..:|.:::.:|...:    .|....:.:...:...:.|::|..
Yeast   800 ELLNMYIGESEANVRRVFQKAREAKPCVIFFDEIDSV----APKRGNQGDSGGVMDRIVSQLLAE 860

  Fly   718 L----KKNDKIVLVGTSNMPWAANGGIKR--AFQKVLLIPKCDYGTSFLLWLELMTEN--APDDM 774
            |    ...|.:.::|.:|.|...:..:.|  .|.|:|.:...|..|..|..||.:|..  ..:|:
Yeast   861 LDGMSTDADGVFVIGATNRPDLLDEALLRPGRFDKLLYLGIPDTDTKQLNILEALTRKFVLDNDV 925

  Fly   775 KEYAYSALARVLQAYNSGDI----DDNVKETLN-----IDRKMRLKNEALDPN----EFLEYFLS 826
            |....:.|...  .|...|.    .|.:...::     :::|:...||....|    .:.:...:
Yeast   926 KLIELAKLCPF--NYTGADFYALCSDAMLNAMSRIARMVEKKVSQHNELTGENISTRRWFDKIAT 988

  Fly   827 KNEPPIFPPDEKIMDKFNKWFGSSNKL 853
            |.       |.|::.|...:..:..:|
Yeast   989 KE-------DTKVVVKMEDFLKAQEQL 1008

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 27/135 (20%)
PEX6NP_014070.1 SpoVK 540..1017 CDD:223540 64/352 (18%)
RecA-like_PEX6_r2 740..899 CDD:410935 33/172 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.