DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and MSP1

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_011542.3 Gene:MSP1 / 852915 SGDID:S000003260 Length:362 Species:Saccharomyces cerevisiae


Alignment Length:270 Identity:62/270 - (22%)
Similarity:103/270 - (38%) Gaps:49/270 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   584 TRDEDGLT-----TLGPAKGDI-KMVIQESMLGMGEFDVP---KPKSLLLIGPLNSGKRLLCEII 639
            |.||..:|     .|.|...|: :.||...|:.....:.|   .|..:||.||...||.:|.:.:
Yeast    82 TPDEINITFQDIGGLDPLISDLHESVIYPLMMPEVYSNSPLLQAPSGVLLYGPPGCGKTMLAKAL 146

  Fly   640 ASELDAVFMNLSPENTY-KYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINP 703
            |.|..|.|:::...:.. |:..:....:..:..:|...||.|::|:|... |.::......|:..
Yeast   147 AKESGANFISIRMSSIMDKWYGESNKIVDAMFSLANKLQPCIIFIDEIDS-FLRERSSTDHEVTA 210

  Fly   704 RLLGTSLASKILKPLKKNDKIVLVGTSNMPWAANGGIKRAFQKVLLI--PKCDYGTSFLLWL--- 763
            .|....:.  :...|..|.:::::|.:|.....:....|...|..|:  |..|.....|..|   
Yeast   211 TLKAEFMT--LWDGLLNNGRVMIIGATNRINDIDDAFLRRLPKRFLVSLPGSDQRYKILSVLLKD 273

  Fly   764 --------------------------ELMTENAPDDMKEYAYSALARVLQAYNSGDIDDNVKETL 802
                                      ||..|.|.|..|||    :.:..|..:||.||.|...:|
Yeast   274 TKLDEDEFDLQLIADNTKGFSGSDLKELCREAALDAAKEY----IKQKRQLIDSGTIDVNDTSSL 334

  Fly   803 NIDRKMRLKN 812
            .| |.::.|:
Yeast   335 KI-RPLKTKD 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 28/131 (21%)
MSP1NP_011542.3 MDN1 <10..>164 CDD:227596 23/81 (28%)
RecA-like_ATAD1 92..255 CDD:410928 35/165 (21%)
AAA_lid_3 280..319 CDD:407720 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.