DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and SPATA5L1

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_076968.2 Gene:SPATA5L1 / 79029 HGNCID:28762 Length:753 Species:Homo sapiens


Alignment Length:359 Identity:72/359 - (20%)
Similarity:144/359 - (40%) Gaps:65/359 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   542 DMTG---DRTLESLYNELK--DAGIIEEIGHRDFDEFITDF-NFVADDTRDEDGLTTLGPAK--- 597
            |:|.   :..:.:|.:..|  |..:|:||      :|:..| |......|...||..:.|..   
Human   407 DLTALCREAAMHALLHSEKNQDNPVIDEI------DFLEAFKNIQPSSFRSVIGLMDIKPVDWEE 465

  Fly   598 ----GDIKMVIQESM----------LGMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELDAVFM 648
                .|:|:.:::|:          :.||   :.:||.:||.||....|..|...:|:.....|:
Human   466 IGGLEDVKLKLKQSIEWPLKFPWEFVRMG---LTQPKGVLLYGPPGCAKTTLVRALATSCHCSFV 527

  Fly   649 NLSPENTYK-YAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFW-KKVPPEAVEINPRLLGTSLA 711
            ::|..:.:. :..|.:..|..|.:.|:|..|.|::::|...:.. :.......::..|:|.. |.
Human   528 SVSGADLFSPFVGDSEKVLSQIFRQARASTPAILFLDEIDSILGARSASKTGCDVQERVLSV-LL 591

  Fly   712 SKI----LKPLKK--------------NDKIVLVGTSNMPWAANGGIKR--AFQKVLLIPKCDYG 756
            :::    ||.:::              |..::::..:|.|...:..:.|  ...|::.||..|: 
Human   592 NELDGVGLKTIERRGSKSSQQEFQEVFNRSVMIIAATNRPDVLDTALLRPGRLDKIIYIPPPDH- 655

  Fly   757 TSFLLWLELMTENAPDDMKEYAYSALARVLQAYNSGDIDDNVKETLNIDRKMRLKNEALDPNEF- 820
            ...|..|::.|:..|.. .:.:...||.....::..|:.:...|.    ..:.|:...||.... 
Human   656 KGRLSILKVCTKTMPIG-PDVSLENLAAETCFFSGADLRNLCTEA----ALLALQENGLDATTVK 715

  Fly   821 LEYFLSK---NEPPIFPPDEKIMDKFNKWFGSSN 851
            .|:||..   .:|.:...|..:.:...|..|.||
Human   716 QEHFLKSLKTVKPSLSCKDLALYENLFKKEGFSN 749

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 27/150 (18%)
SPATA5L1NP_076968.2 CDC48 22..746 CDD:273521 69/354 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 171..203
AAA 237..367 CDD:278434
AAA 501..651 CDD:278434 27/150 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.