DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and spata5l1

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001070056.2 Gene:spata5l1 / 767648 ZFINID:ZDB-GENE-060929-204 Length:748 Species:Danio rerio


Alignment Length:325 Identity:62/325 - (19%)
Similarity:118/325 - (36%) Gaps:92/325 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   495 RGLVDEYMRVEYELLREALAKD----------NDEKYKALKVKYPKKKKEKRKKKPKDMTGDRTL 549
            |.|.|.|:::..:.:...|.|.          ..:....||:...|.|...::.:.|....:|:|
Zfish    54 RDLADGYLQISSQCVSPDLHKHTLTALTVHPAQIKPLTCLKLTCVKLKVFVQRLEHKKRVSERSL 118

  Fly   550 ESLYNELKDAGIIEEIGHRDFDEFITDFNFVADDTR-----------DEDGLTT----------- 592
            :.|.:     ||....||      :.|.:.|..:.|           ...||.|           
Zfish   119 QELLD-----GIYVHEGH------LVDLSGVKAEIRCVLVEKVNSGSQRAGLITARTCVDISTIQ 172

  Fly   593 -------------LGPAKG--DIKMVIQESML-------GMGEFDVPKPKSLLLIGPLNSGKRLL 635
                         ..|..|  |:...::|.:.       .:.:..:..|:.||||||...||.||
Zfish   173 TVKHLDRQQQQVSAAPLGGMEDVFASLKEMITFPLRYPGSLRQLGLSCPRGLLLIGPPGVGKTLL 237

  Fly   636 CEIIASELDAVFMNLS-PENTYKYAKDLKYFLHVILKVAKAFQ---PTIMYIEEAHRLFWKKVPP 696
            ...:|.::.|..:.:: ||.|.....:.:..|..:.:.|:...   |.::.|:|...|.      
Zfish   238 VRCVAKDIGATLVTVNGPEVTGSRPGESEENLRRVFEQARDAADDGPCVLLIDEIDSLC------ 296

  Fly   697 EAVEINPRLLGTSLASK---------ILKPLKKNDKIVLVGTSNMPWAANGGIKR--AFQKVLLI 750
                  ||..|:|.|.:         ::..:..::..|::|.:|.|.:.:..::|  .|.:.::|
Zfish   297 ------PRRTGSSSAPENRLVAQLLTLMDAIGSHEGFVIIGATNQPDSLDPALRRPGRFDREVII 355

  Fly   751  750
            Zfish   356  355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 33/144 (23%)
spata5l1NP_001070056.2 CDC48 13..740 CDD:273521 62/325 (19%)
AAA 224..357 CDD:278434 33/144 (23%)
AAA 489..655 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.