DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and Spata5l1

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001103117.1 Gene:Spata5l1 / 691729 RGDID:1595990 Length:747 Species:Rattus norvegicus


Alignment Length:374 Identity:75/374 - (20%)
Similarity:135/374 - (36%) Gaps:93/374 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   473 KNHDPIKEWVTEEQLAKIHQEVRGLVDEYMRVEY------ELLREALAKDNDEKYKALKVKYPKK 531
            |..:.|...:|.:.....|.:: ||:.| |.|.|      .|.|||..       .||      .
  Rat   367 KQREAILGVITSKMPISSHIDL-GLLAE-MTVGYVGADLTALCREAAT-------CAL------L 416

  Fly   532 KKEKRKKKPKDMTGDRTLESLYNELKDAGIIEEIGHRDFDEFITDFNFVADDT-RDEDGLTTLGP 595
            |.||.:..||                    |||      .:|:..|..|...: |...|||.:.|
  Rat   417 KNEKNQNNPK--------------------IEE------TDFLEAFKKVQPSSFRSSIGLTDIRP 455

  Fly   596 -------AKGDIKMVIQ----------ESMLGMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASEL 643
                   ...|:|:.::          :....||   :.:||.|||.||....|..|...:|:..
  Rat   456 VGWEQIGGLEDVKLKLKQCVEWPLKFPQEFARMG---LTQPKGLLLYGPPGCAKTTLVRALATSC 517

  Fly   644 DAVFMNLSPENTYK-YAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFW-KKVPPEAVEINPRLL 706
            ...|:::...:.:. :..|.:..|..:.:.|:|..|.:::::|...:.. :.|.....:...|:|
  Rat   518 HCSFVSVCGADLFSPFVGDSEKVLSQVFRQARANTPALVFLDEIDSVLGSRSVGSSGCDARERVL 582

  Fly   707 ------------------GTSLASKILKPLKKNDKIVLVGTSNMPWAANGGIKR--AFQKVLLIP 751
                              |:..:.:..:.:.....:::|.| |.|...:..:.|  ...|::.:|
  Rat   583 SVLLNELDGVGVRTVERRGSKASQQECQEILSRSVMIVVAT-NRPDVLDDALLRPGRLDKMVYVP 646

  Fly   752 KCDYGTSFLLWLELMTENAPDDMKEYAYSALARVLQAYNSGDIDDNVKE 800
            ..| ....|..|::.|.|.|..: ..:...||.....::..|:.:..||
  Rat   647 PPD-REGRLSILKVCTNNMPIGL-NVSLENLAAETCYFSGADLRNLCKE 693

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 25/150 (17%)
Spata5l1NP_001103117.1 CDC48 14..738 CDD:273521 75/374 (20%)
AAA 230..362 CDD:278434
AAA 496..646 CDD:278434 25/150 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.