DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and Fignl2

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001201840.1 Gene:Fignl2 / 668225 MGIID:3646919 Length:644 Species:Mus musculus


Alignment Length:287 Identity:59/287 - (20%)
Similarity:110/287 - (38%) Gaps:66/287 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   597 KGDIKMVIQESML----------GMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELDAVFM--- 648
            :|.:|..::|.:|          |..   :| |:::|..||...||.||...:|:.|.|..:   
Mouse   392 QGALKAALEEELLWPLLRPPACPGSA---LP-PRTVLFFGPRGCGKALLGRCLATRLGATLLRLR 452

  Fly   649 --NLSPENTYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPRLLGTSLA 711
              .|:.....:.|:    .|......|:...|.::.|.|...|           :..|..|.||.
Mouse   453 GAGLAASGAVEGAR----LLQAAFAAARCRPPAVLLISELDAL-----------LPARDDGASLR 502

  Fly   712 SKILKPL-----KKNDKIVLVGTSNMPWAANGGIKRAFQKVLLIPKCD-YGTSFLLWLELMTENA 770
            :.:|..|     .:.|.:::|||::.|.|.:...:|.|.....:...| .....:|...|..:..
Mouse   503 APLLTCLDGSCGARADGVLVVGTTSRPAALDEATRRRFALRFYVALPDGAARGQILQRALAQQGC 567

  Fly   771 PDDMKEYAYSALARVLQAYNSGDIDDNVKETL------NIDRKMRLKNEALDPNEFLEYFLSK-- 827
            ..:.:|.|  ||.:..|.::.|::....::..      .:.|.:..|:        :|..|:|  
Mouse   568 ALNERELA--ALVQGTQGFSGGELGQLCQQAAAEAGISGLQRPLSYKD--------VEAALAKVG 622

  Fly   828 NEPPIFPPDEKIMDKFNKW---FGSSN 851
            :..|     .|.:|...:|   :||.:
Mouse   623 SRAP-----SKELDSLVEWDKMYGSGH 644

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 32/138 (23%)
Fignl2NP_001201840.1 SpoVK <381..638 CDD:223540 57/279 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.