DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and Spata5

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001156983.1 Gene:Spata5 / 57815 MGIID:1927170 Length:893 Species:Mus musculus


Alignment Length:434 Identity:91/434 - (20%)
Similarity:163/434 - (37%) Gaps:130/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   493 EVRGLVDEYMRVEYELLREALAKDNDEKYKALKVKYPKKKKEKRKKKPKDMTGDRTLESLYNELK 557
            :.:|:..|:..:|        :.|.|..::..::...:.:....:..|...|.|||:......|.
Mouse   212 DAQGMASEHSSME--------SSDVDLSFQLSQLDLKEPQSPSSQSTPCKPTNDRTVNKAGEVLL 268

  Fly   558 DA----------GIIEEIGHR-DFD-----------------------EFITD-FNFVADDTR-- 585
            |.          |:.|..|.: .||                       :..|| |.|::..||  
Mouse   269 DVTQSPRDGSGLGLEESTGLKCSFDSSKEGNTQPVSEEKLLKPASAGTKSNTDTFYFISSTTRIN 333

  Fly   586 ---------DEDG-----LTTLGPAKGDIKMV--IQESMLGMGE----FDVPKPKSLLLIGPLNS 630
                     ::|.     ...:|.....:|.:  |.|..|...|    :.:|.|:.|||.||..:
Mouse   334 LRKICTNSKEQDSQFKVTYDMIGGLNSQLKAIREIIELPLKQPELFKSYGIPAPRGLLLYGPPGT 398

  Fly   631 GKRLLCEIIASELDA-VFMNLSPENTYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKV 694
            ||.::...:|:|:.| |.:...||...|:..:.:..|..|...|....|:|::|:|...|..|:.
Mouse   399 GKTMIARAVANEVGAYVSVINGPEIISKFYGETEARLRQIFAEATLRHPSIIFIDELDALCPKRE 463

  Fly   695 PPEAVEINPRLLGTSLASKILKPL---KKNDKIVLVGTSNMPWAANGGIKR-------------- 742
            ..:: |:..|::.:.|.  ::..:   ....:::::|.:|.|.|.:..::|              
Mouse   464 GAQS-EVEKRVVASLLT--LMDGIGSEGSEGRVLVLGATNRPQALDAALRRPGRFDKEIEIGIPN 525

  Fly   743 ------AFQKVL-----LIPKCDYGTSFLLWLELMTENAPD----DMK----EYAYSALARVLQA 788
                  ..||:|     |:.|.:        |..:..||..    |:|    |....||.|||: 
Mouse   526 AQDRLDILQKLLRRVPHLLTKAE--------LLRLANNAHGYVGADLKALCNEAGLHALRRVLR- 581

  Fly   789 YNSGDIDDN-----VKETLNID--------RKMRLKNEALD-PN 818
             ...::.|:     ||.||| |        |...::..|:| ||
Mouse   582 -KQPNLPDSKVAGMVKITLN-DFLQGMNDIRPSAMREVAIDVPN 623

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 35/157 (22%)
Spata5NP_001156983.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..38
CDC48_N 64..132 CDD:304500
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 202..227 3/22 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 239..315 12/75 (16%)
SpoVK 370..882 CDD:223540 64/268 (24%)
AAA 390..522 CDD:278434 31/134 (23%)
AAA 664..796 CDD:278434
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.