DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and fignl2

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001201837.1 Gene:fignl2 / 561837 ZFINID:ZDB-GENE-090313-189 Length:684 Species:Danio rerio


Alignment Length:237 Identity:49/237 - (20%)
Similarity:85/237 - (35%) Gaps:75/237 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   531 KKKEKRKKKPKDMTGDRTLESLYNELKDAGIIEEIGHRDFDEFITDFNFVADDTRDEDGLTTLGP 595
            :.:.:::..|......|.||.:..||:|.                                  .|
Zfish   393 QNRSQKRSDPMKSIEPRMLELVSRELQDC----------------------------------SP 423

  Fly   596 A------KGD--IKMVIQESMLGMGEFDVPK-------PKSLLLIGPLNSGKRLLCEIIASELDA 645
            |      .|:  ||..::|.:|    :.|.:       ||::||.||...||..|...::|::.|
Zfish   424 AMLWTELAGNCHIKAALEEDLL----WPVLRPNPAIHPPKTILLFGPQGGGKTTLARSLSSQIGA 484

  Fly   646 VFMNLSPEN-TYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPRLLGTS 709
            .|..||... ..|...:.:..|..:..||.|.||.::.:.|.          ||:|      ...
Zfish   485 SFYRLSCATLASKLKGEAEQLLLTLFSVATARQPAMVLLSEV----------EAIE------EEG 533

  Fly   710 LASKILKPLKK-----NDKIVLVGTSNMPWAANGGIKRAFQK 746
            |..::...|:|     :::.::|.|:..|......:.|.|.|
Zfish   534 LRQQLQAQLEKIQHNQSNQFLVVCTTRRPDLIKDSLLRCFSK 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 32/131 (24%)
fignl2NP_001201837.1 AAA 457..583 CDD:214640 34/135 (25%)
AAA 461..581 CDD:278434 32/131 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.