DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and fign

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:XP_021334341.1 Gene:fign / 553599 ZFINID:ZDB-GENE-050522-339 Length:747 Species:Danio rerio


Alignment Length:342 Identity:75/342 - (21%)
Similarity:131/342 - (38%) Gaps:84/342 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   550 ESLYNELKDAGIIEEIGHRDFDEFITDFNFVADDTRDEDGLTTLGPAKGDIKMVIQESMLGMGEF 614
            |.|.|  .||.::         |.:|..........|...:..|..||..||..:...:|....|
Zfish   448 EQLKN--SDASLV---------EMVTTEILQQTPPVDWSDIAGLEMAKATIKDEVLWPILRPDMF 501

  Fly   615 D--VPKPKSLLLIGPLNSGKRLLCEIIASELDAVFMNLSPEN-TYKYAKDLKYFLHVILKVAKAF 676
            .  ...|:|:||.||..:|:.||...:||:|.|.|:.||... ..|:..:.:..:.....:|:..
Zfish   502 SGLATLPRSILLFGPQGTGRTLLGRCMASQLGAAFLLLSGSALVTKWLGEGEKIVQASFLIARCR 566

  Fly   677 QPTIMYIEEAHRLFWKKVPPEAVEINPRLLGTSLASKILKPL-----KKNDKIVLVGTSNMPWAA 736
            ||::::|.:...|...::..|: .:|      .:.|::|..|     ...:.:::|.:::.|...
Zfish   567 QPSVVFISDVDLLLSSQLSEES-PVN------RIKSELLLQLDGVLSSPEEHVLVVCSTSKPEEI 624

  Fly   737 NGGIKRAFQKVLLIPKCDYGTSFLLWLELMTENAPDDMKEYAYSALARVLQAYNSGDIDDNVKET 801
            :..::|.|.|.||:|                  .||....  :..::::|..:|....|..|  |
Zfish   625 DESLRRYFVKRLLVP------------------LPDATAR--HQIISQLLSQHNYCLSDKEV--T 667

  Fly   802 LNIDRK--------MRLKNEAL---------------DPNEF-------LEYFLSKNEPPIFPPD 836
            |.:.|.        :||..|||               .|.:.       .|....|.:|.|   .
Zfish   668 LLVQRTDGFSGLDVVRLCQEALVGPLHGMPGADLSGMIPGQMRPVSYQDFENVFCKIQPSI---S 729

  Fly   837 EKIMDKFNKW---FGSS 850
            :|.:|.:.:|   ||.|
Zfish   730 QKELDTYTEWNKMFGCS 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 32/134 (24%)
fignXP_021334341.1 EBV-NA3 <174..300 CDD:332796
Herpes_UL32 <270..>444 CDD:283680
SpoVK <464..734 CDD:223540 63/301 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.