DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and spast

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:XP_012818464.1 Gene:spast / 549207 XenbaseID:XB-GENE-947839 Length:603 Species:Xenopus tropicalis


Alignment Length:356 Identity:84/356 - (23%)
Similarity:148/356 - (41%) Gaps:72/356 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 KKEKRKKKP---------KDMTGDRTLES-----LYNELKDAG---IIEEIGHRDFDEFITDFNF 579
            |...|..||         |||...|.::|     :.||:.|:|   ...:|..:|..:.......
 Frog   281 KNNTRTNKPTTPTTAVRKKDMKNLRNVDSNLANLILNEIVDSGPTVKFADIAGQDLAKQALQEIV 345

  Fly   580 VADDTRDEDGLTTLGPAKGDIKMVIQESMLGMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELD 644
            :....|.|.......||:|                       |||.||..:||.:|.:.:|:|.:
 Frog   346 ILPSIRPELFTGLRAPARG-----------------------LLLFGPPGNGKTMLAKAVAAESN 387

  Fly   645 AVFMNLSPEN-TYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPRLLGT 708
            |.|.|:|..: |.||..:.:..:..:..||:..||:|::|:|...|..:           |..|.
 Frog   388 ATFFNISAASLTSKYVGEGEKLVRALFSVARELQPSIIFIDEVDSLLCE-----------RREGE 441

  Fly   709 SLASKILK----------PLKKNDKIVLVGTSNMPWAANGGIKRAFQKVLLIPKCDYGTSFLLWL 763
            ..||:.||          ....:|:::::|.:|.|...:..:.|.|.|.:.:...:..|..||..
 Frog   442 HDASRRLKTEFLIEFDGVQSGGDDRVLVMGATNRPQELDDAVLRRFTKRVYVSLPNEETRLLLLK 506

  Fly   764 ELMTENAPDDMKEYAYSALARVLQAYNSGDIDDNVKE-TLNIDRKMR---LKNEALDPNEFLEY- 823
            .|:::.. :.:.|...:.|:|:.:.|:..||....|: .|...|:::   :||.|......::| 
 Frog   507 NLLSKQG-NPLNEKELTQLSRLTEGYSGSDITALAKDAALGPIRELKPEQVKNMAASEMRNIKYS 570

  Fly   824 -FLS---KNEPPIFPPDEKIMDKFNKWFGSS 850
             |||   |.:..:.|...:...::||.||.:
 Frog   571 DFLSSLKKIKCSVSPSTLESYIRWNKEFGDT 601

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 38/139 (27%)
spastXP_012818464.1 MIT_spastin 110..188 CDD:239142
SpoVK <278..584 CDD:223540 79/337 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.