DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and PEX6

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_000278.3 Gene:PEX6 / 5190 HGNCID:8859 Length:980 Species:Homo sapiens


Alignment Length:244 Identity:54/244 - (22%)
Similarity:95/244 - (38%) Gaps:33/244 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 LGPAKGDIKMVIQ-----ESMLGMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELDAVFMNL-S 651
            |...|.:|...||     ..:|.:|    .:...|||.||..:||.||.:.:|:|....|::: .
Human   710 LQEVKKEILETIQLPLEHPELLSLG----LRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKG 770

  Fly   652 PENTYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPP-----EAVEINPRLLGTSLA 711
            ||....|....:..:..:...|:|..|.|::.:|...|    .|.     ::..:..|::...||
Human   771 PELINMYVGQSEENVREVFARARAAAPCIIFFDELDSL----APSRGRSGDSGGVMDRVVSQLLA 831

  Fly   712 SKILKPLKKNDKIVLVGTSNMPWAANGGIKR--AFQKVLLIPKCDYGTSFLLWLELMTENAPDDM 774
            .  |..|.....:.::|.:|.|...:..:.|  .|.|::.:...:...|.|..|..:|..    .
Human   832 E--LDGLHSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVGANEDRASQLRVLSAITRK----F 890

  Fly   775 KEYAYSALARVLQA----YNSGDIDDNVKETLNIDRKMRLKN--EALDP 817
            |.....:|..||..    ....|:.....:.:....|.|:.:  |.|:|
Human   891 KLEPSVSLVNVLDCCPPQLTGADLYSLCSDAMTAALKRRVHDLEEGLEP 939

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 33/136 (24%)
PEX6NP_000278.3 SpoVK 463..967 CDD:223540 54/244 (22%)
AAA 466..594 CDD:278434
AAA 743..871 CDD:278434 30/133 (23%)
Vps4_C 918..977 CDD:286426 5/22 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.