DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and atad1b

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001019592.1 Gene:atad1b / 368412 ZFINID:ZDB-GENE-030616-44 Length:362 Species:Danio rerio


Alignment Length:304 Identity:61/304 - (20%)
Similarity:112/304 - (36%) Gaps:77/304 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   530 KKKKEKRKKKPKDM--TGDRTLE-SLYNELKDAGIIEEIGHR-------DFDEFITDFNFVADDT 584
            |:|.|.:|:..|.|  .|.:.:: |.|.....|.:::.:..:       ..||.||:.       
Zfish    50 KQKVEAQKQAEKLMRQIGVQNVKLSEYEMSIAAHLVDPLTMQITWYDIAGLDEVITEL------- 107

  Fly   585 RDEDGLTTLGPAKGDIKMVIQESMLGMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELDAVFMN 649
                        |..:.:.||:..|..|...:..||.:||.||...||.|:.:..|.|....|:|
Zfish   108 ------------KDTVILPIQKRHLFEGSRLLQPPKGVLLYGPPGCGKTLIAKATAKEAGFRFIN 160

  Fly   650 LSPEN-TYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPRLLGTSLASK 713
            |.|.. |.|:..:.:.....:..:|...||:|::|:|....           :..|......|:.
Zfish   161 LQPSTLTDKWYGESQKLAAAVFSLAIKLQPSIIFIDEIDSF-----------LRNRSSSDHEATA 214

  Fly   714 ILK----------PLKKNDKIVLVGTSNMPWAANGGIKRAFQKVLLIPKCDYGTSF--------- 759
            ::|          ....|.:::::|.:|.|...:..|.|...           |.|         
Zfish   215 MMKAQFMSLWDGLDTDYNCQVIIMGATNRPQDLDSAILRRMP-----------TRFHINQPNARQ 268

  Fly   760 ---LLWLELMTENAPDDMKEYAYSALARVLQAYNSGDIDDNVKE 800
               :|.|.|..||....::   .|.:|:....::..|:.:..::
Zfish   269 RKDILKLILENENVESAVE---LSEIAKQTDGFSGSDLREMCRD 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 30/139 (22%)
atad1bNP_001019592.1 AAA 129..258 CDD:214640 32/150 (21%)
AAA 133..261 CDD:278434 32/149 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.