DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and Fign

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001099954.1 Gene:Fign / 295649 RGDID:1308174 Length:759 Species:Rattus norvegicus


Alignment Length:414 Identity:94/414 - (22%)
Similarity:168/414 - (40%) Gaps:73/414 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   477 PIKEWVTEEQLAKI-HQEVRGLVDEYMRVEYELLREALAKDNDEKYKALKVKYPKKKKEKRKKKP 540
            |.|:.:..||..|. .|..|.|...    .|...:.:|...:.|.:.    ||......:.    
  Rat   378 PTKQLMPSEQQRKFSSQSSRALTPP----SYSTAKNSLGSRSSESFG----KYTSPVMSEH---- 430

  Fly   541 KDMTGDRTLESLYNELKDAGI-IEEIGHRDFDEFI--TDFNFVADDTRDEDGLTTLGP------- 595
                ||...:.|.:.::..|: .....:...||.:  ||.:.:...|.:   :.|.||       
  Rat   431 ----GDDHRQLLAHPIQGPGLRAATSSNHSVDEQLKNTDTHLIDLVTNE---IITQGPPVDWSDI 488

  Fly   596 AKGD-IKMVIQESML----------GMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELDAVFMN 649
            |..| :|.||:|.:|          |:    ...|:|:||.||..:||.||...|||:|.|.|..
  Rat   489 AGLDLVKAVIKEEVLWPVLRSDAFSGL----TALPRSILLFGPRGTGKTLLGRCIASQLGATFFK 549

  Fly   650 LSPEN-TYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPRL-------L 706
            ::... ..|:..:.:..:|....||:..||:::::.:...|...:|..|...:: |:       |
  Rat   550 IAGSGLVAKWLGEAEKIIHASFLVARCRQPSVIFVSDIDMLLSSQVSEEHSPVS-RMRTEFLMQL 613

  Fly   707 GTSLASKILKPLKKNDKIVLVGTSNMPWAANGGIKRAFQKVLLIPKCDYGTSFLLWLELMTE-NA 770
            .|.|.|       ..|:||::..::.|...:..::|.|.|.||||..|......:.::|::: |.
  Rat   614 DTVLTS-------AEDQIVVICATSKPEEIDESLRRYFMKRLLIPLPDSTARHQIIVQLLSQHNY 671

  Fly   771 PDDMKEYAYSALARVLQAYNSGDIDDNVKETL--NIDRKMRLKNEALDPNEF-------LEYFLS 826
            ..:.||:|  .|.:..:.::..|:....:|..  .:.........|:.|::.       .|....
  Rat   672 CLNDKEFA--LLVQRTEGFSGLDVAHLCQEAAVGPLHAMPATDLSAIMPSQLRPITYQDFENAFC 734

  Fly   827 KNEPPIFPPDEKIMDKFNKWFGSS 850
            |.:|.|...:..:..::||.||.|
  Rat   735 KIQPSISQKELDMYVEWNKMFGCS 758

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 37/136 (27%)
FignNP_001099954.1 AAA 519..654 CDD:214640 41/142 (29%)
AAA 522..652 CDD:278434 38/137 (28%)
Vps4_C <723..756 CDD:286426 6/32 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.