DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and Trip13

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001011930.1 Gene:Trip13 / 292206 RGDID:1308516 Length:432 Species:Rattus norvegicus


Alignment Length:247 Identity:52/247 - (21%)
Similarity:97/247 - (39%) Gaps:52/247 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   622 LLLIGPLNSGKRLLCEIIASELDAVFMNLSPENTYKYAKDLKYFLHVILK---------VAKAFQ 677
            :||.||..:||..||:.:|.:|.   :.||  :.|:|.:.::...|.:..         |.|.||
  Rat   175 VLLHGPPGTGKTSLCKALAQKLT---IRLS--SRYRYGQLIEINSHSLFSKWFSESGKLVTKMFQ 234

  Fly   678 PTIMYIEEAHRLFWKKV------------------PPEAVEINPRLLGTSLASKILKPLKKNDKI 724
            .....|::...|.:..:                  |.:|:    |::...|..  :..:|::..:
  Rat   235 KIQDLIDDKEALVFVLIDEVESLTAARNACRAGAEPSDAI----RVVNAVLTQ--IDQIKRHSNV 293

  Fly   725 VLVGTSNMPWAAN-GGIKRAFQKVLLIPKCDYGTSFLLWLELMTENAPDDMK---EYAYSALARV 785
            |::.|||:....: ..:.||..|..:.|. .....|.::|..:.|.    ||   .|....|..:
  Rat   294 VILTTSNITEKIDVAFVDRADIKQYIGPP-SAAAIFKIYLSCLEEL----MKCQIIYPRQQLLTL 353

  Fly   786 LQAYNSGDIDDNVKETLNIDRKMRLKNEALDPN-----EFLEYFLSKNEPPI 832
            .:....|.|::||.:...:..::..|:|.|...     .||.:.|....|.:
  Rat   354 RELEMIGFIENNVSKLSLLLSEISRKSEGLSGRVLRKLPFLAHALYIQAPSV 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 33/156 (21%)
Trip13NP_001011930.1 RecA-like_Pch2-like 121..319 CDD:410916 33/154 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.