DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and Pex6

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_663463.1 Gene:Pex6 / 224824 MGIID:2385054 Length:981 Species:Mus musculus


Alignment Length:289 Identity:62/289 - (21%)
Similarity:112/289 - (38%) Gaps:43/289 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 DIKMVIQES---------MLGMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELDAVFMNL-SPE 653
            |:|..|.|:         :|.:|    .:...|||.||..:||.||.:.:|:|....|::: .||
Mouse   713 DVKKEILETIQLPLEHPELLSLG----LRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKGPE 773

  Fly   654 NTYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPP-----EAVEINPRLLGTSLASK 713
            ....|....:..:..:...|:|..|.|::.:|...|    .|.     ::..:..|::...||. 
Mouse   774 LINMYVGQSEENVREVFARARAAAPCIIFFDELDSL----APSRGRSGDSGGVMDRVVSQLLAE- 833

  Fly   714 ILKPLKKNDKIVLVGTSNMPWAANGGIKR--AFQKVLLIPKCDYGTSFLLWLELMTENAPDDMKE 776
             |..|.....:.::|.:|.|...:..:.|  .|.|::.:...:...|.|..|..:|..    .|.
Mouse   834 -LDGLHSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVGASEDRASQLRVLSAITRK----FKL 893

  Fly   777 YAYSALARVLQA----YNSGDIDDNVKETLNIDRKMRLKNEALDPNEFLEYFLSKNEPPIFPPDE 837
            .|..:||.||..    ....|:.....:.:....|.|:::        ||..|......:....|
Mouse   894 EASVSLANVLDCCPPQLTGADLYSLCSDAMMTALKRRVRD--------LEEGLELRSSALLLTME 950

  Fly   838 KIMDKFNKWFGSSNKLEKLRKSYMAQKLA 866
            .::....:...|.::.|.||...:.:|.|
Mouse   951 DLLQAAARLQPSVSEQELLRYKRIQRKFA 979

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 33/136 (24%)
Pex6NP_663463.1 SpoVK 464..968 CDD:223540 57/276 (21%)
AAA 467..596 CDD:278434
AAA 744..872 CDD:278434 30/133 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.