DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and Pex6

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_476466.1 Gene:Pex6 / 117265 RGDID:621637 Length:978 Species:Rattus norvegicus


Alignment Length:242 Identity:54/242 - (22%)
Similarity:97/242 - (40%) Gaps:37/242 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 DIKMVIQES---------MLGMGEFDVPKPKSLLLIGPLNSGKRLLCEIIASELDAVFMNL-SPE 653
            |:|..|.|:         :|.:|    .:...|||.||..:||.||.:.:|:|....|::: .||
  Rat   710 DVKKEILETIQLPLEHPELLSLG----LRRSGLLLHGPPGTGKTLLAKAVATECSLTFLSVKGPE 770

  Fly   654 NTYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPP-----EAVEINPRLLGTSLASK 713
            ....|....:..:..:...|:|..|.|::.:|...|    .|.     ::..:..|::...||. 
  Rat   771 LINMYVGQSEENVREVFARARAAAPCIIFFDELDSL----APSRGRSGDSGGVMDRVVSQLLAE- 830

  Fly   714 ILKPLKKNDKIVLVGTSNMPWAANGGIKR--AFQKVLLIPKCDYGTSFLLWLELMTENAPDDMKE 776
             |..|.....:.::|.:|.|...:..:.|  .|.|::.:...:...|.|..|..:|..    .|.
  Rat   831 -LDGLHSTQDVFVIGATNRPDLLDPALLRPGRFDKLVFVGASEDRASQLRVLSAITRK----FKL 890

  Fly   777 YAYSALARVLQA----YNSGDIDDNVKETL--NIDRKMRLKNEALDP 817
            .|..:|..||..    ....|:.....:.:  .:.|::|...|.|:|
  Rat   891 EASVSLMNVLDCCPPQLTGADLYSLCSDAMMTALKRRVRDLEEGLEP 937

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 33/136 (24%)
Pex6NP_476466.1 SpoVK 463..965 CDD:223540 54/242 (22%)
AAA 466..595 CDD:278434
AAA 741..869 CDD:278434 30/133 (23%)
Vps4_C 923..975 CDD:286426 5/15 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.