DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and Vcp

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_446316.1 Gene:Vcp / 116643 RGDID:621595 Length:806 Species:Rattus norvegicus


Alignment Length:279 Identity:65/279 - (23%)
Similarity:126/279 - (45%) Gaps:42/279 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 DDTRDEDGLTTLGPAK---GDIKMVIQESMLGMGEF---DVPKPKSLLLIGPLNSGKRLLCEIIA 640
            :::.:|.|...:|..:   ..||.:::..:.....|   .|..|:.:||.||..:||.|:...:|
  Rat   195 EESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRGILLYGPPGTGKTLIARAVA 259

  Fly   641 SELDAVFMNLS-PENTYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPEAVEINPR 704
            :|..|.|..:: ||...|.|.:.:..|....:.|:...|.|::|:|...:..|:..... |:..|
  Rat   260 NETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAIIFIDELDAIAPKREKTHG-EVERR 323

  Fly   705 LLGTSLASKILKPLKKNDKIVLVGTSNMPWAANGGIKR--AFQKVLLIPKCDYG----TSFLLWL 763
            ::...|.  ::..||:...::::..:|.|.:.:..::|  .|.:     :.|.|    |..|..|
  Rat   324 IVSQLLT--LMDGLKQRAHVIVMAATNRPNSIDPALRRFGRFDR-----EVDIGIPDATGRLEIL 381

  Fly   764 ELMTEN---APD-DMKEYAYSALARV------------LQAYNSG-DIDDNVKETLNIDRKMRLK 811
            ::.|:|   |.| |:::.|......|            |||.... |:.|...||  ||.:: :.
  Rat   382 QIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAALQAIRKKMDLIDLEDET--IDAEV-MN 443

  Fly   812 NEALDPNEFLEYFLSKNEP 830
            :.|:..::| .:.||::.|
  Rat   444 SLAVTMDDF-RWALSQSNP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 31/131 (24%)
VcpNP_446316.1 CDC48 25..764 CDD:273521 65/279 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 708..727
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 768..806
Interaction with UBXN6. /evidence=ECO:0000250 797..806
PIM motif. /evidence=ECO:0000250|UniProtKB:P55072 802..806
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0464
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.