DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14183 and fignl1

DIOPT Version :9

Sequence 1:NP_649172.3 Gene:CG14183 / 40192 FlyBaseID:FBgn0036931 Length:872 Species:Drosophila melanogaster
Sequence 2:NP_001096311.1 Gene:fignl1 / 100124890 XenbaseID:XB-GENE-1000359 Length:656 Species:Xenopus tropicalis


Alignment Length:287 Identity:73/287 - (25%)
Similarity:128/287 - (44%) Gaps:42/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   588 DGLTTLGPAKGDIKMVIQESMLGMGEFDVPK--PKSLLLIGPLNSGKRLLCEIIASELDAVFMNL 650
            |.:..|..||..||.::...||....|...:  ||.:||.||..:||.|:.:.||.:..|.|.::
 Frog   383 DDIAGLEFAKTTIKEIVVWPMLRPDIFTGLRGPPKGILLFGPPGTGKTLIGKCIACQSGATFFSI 447

  Fly   651 SPEN-TYKYAKDLKYFLHVILKVAKAFQPTIMYIEEAHRLFWKKVPPE-------AVEINPRLLG 707
            |..: |.|:..:.:..:..:..||:..||.:::|:|...|..::...|       ..|...:|.|
 Frog   448 SASSLTSKWVGEGEKMVRALFTVARCHQPAVIFIDEIDSLLSQRGEGEHESSRRIKTEFLVQLDG 512

  Fly   708 TSLASKILKPLKKNDKIVLVGTSNMPWAANGGIKRAFQKVLLIPKCDYGTSFLLWLELMTENAPD 772
            .:.:|        :|:|::||.:|.|...:...:|...|.|.||..:......:.:.||.     
 Frog   513 ATTSS--------DDRILVVGATNRPQEIDEAARRRLVKRLYIPLPEASARKQIVVSLMA----- 564

  Fly   773 DMKEYAYSA----LARVLQA--YNSGDIDDNVKE-TLNIDRKMRLKN------EALDPNEFLEY- 823
              ||:...|    .|.||||  ::..|:....:| .|...|.::|.:      |.:.|..:::: 
 Frog   565 --KEHCSLAEQEVEAIVLQADGFSGADMTQLCREAALGPIRSIQLMDISTITPEQVRPIAYIDFQ 627

  Fly   824 --FLSKNEPPIFPPDEKIMDKFNKWFG 848
              ||.. .|.:...|.::.:.:||.||
 Frog   628 SAFLVV-RPSVSQKDLELYENWNKTFG 653

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14183NP_649172.3 AAA 622..751 CDD:278434 35/136 (26%)
fignl1NP_001096311.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..354
SpoVK <356..650 CDD:223540 69/282 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.