DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and ANGPTL1

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001363692.1 Gene:ANGPTL1 / 9068 HGNCID:489 Length:491 Species:Homo sapiens


Alignment Length:492 Identity:108/492 - (21%)
Similarity:194/492 - (39%) Gaps:136/492 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 GMLKHKKKDERKISELTRKLAEAE-----INLKAQQEKGSILENCIKDKDDFIKTLQLSIDLVTQ 100
            |..|.||.::|:....|....||:     ..:..|:..|.|   |:..|.....|::   |::|:
Human    24 GQFKIKKINQRRYPRATDGKEEAKKCAYTFLVPEQRITGPI---CVNTKGQDASTIK---DMITR 82

  Fly   101 TKEMTIQKLQTQIMDLQSDLDLSRITIKKNDGGNCAPAHDKVVKERKELNMENGKFREGNDQIVE 165
               |.::.|:..:...:.::|:.::.:..:  ||       :|.|.|.|..|:   |..|.::.:
Human    83 ---MDLENLKDVLSRQKREIDVLQLVVDVD--GN-------IVNEVKLLRKES---RNMNSRVTQ 132

  Fly   166 -----IEKILNSKE--AEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNV------ 217
                 :.:|:..::  .|:::||.||.....:::::....:..:.|...:|::::..:|      
Human   133 LYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQSVMITLLE 197

  Fly   218 ---------------------------NNKDHDEFVLLGS----------SKLPSIKLVTLPDFE 245
                                       |::.:...:|.|:          ..:|...|.|.|...
Human   198 EQCLRIFSRQDTHVSPPLVQVVPQHIPNSQQYTPGLLGGNEIQRDPGYPRDLMPPPDLATSPTKS 262

  Fly   246 PF---------ASVFEDIPSAGR-------------------------------GWMIIQRRIDG 270
            ||         ...|:|...|..                               ||.:||:|.||
Human   263 PFKIPPVTFINEGPFKDCQQAKEAGHSVSGIYMIKPENSNGPMQLWCENSLDPGGWTVIQKRTDG 327

  Fly   271 S---FDNATESNIITGCGDLGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGD 332
            |   |.|  ..|...|.|::.||:||||:.::.::.....:|.|:|.|:.:...||.|.:|.:..
Human   328 SVNFFRN--WENYKKGFGNIDGEYWLGLENIYMLSNQDNYKLLIELEDWSDKKVYAEYSSFRLEP 390

  Fly   333 EKQKYKLLSLGEYSGNAGDAFRSH----------INHIIVGNPFAMESSKWW--GTMNCNLNGK- 384
            |.:.|: |.||.|.|||||:...|          ...:..||........||  ...:.||||. 
Human   391 ESEFYR-LRLGTYQGNAGDSMMWHNGKQFTTLDRDKDMYAGNCAHFHKGGWWYNACAHSNLNGVW 454

  Fly   385 YRNSKVELDTTDGIWWGNWNVGNRYPLKSCKMLIRPM 421
            ||.........|||:|..:. |..|.|::.:|:|:|:
Human   455 YRGGHYRSKHQDGIFWAEYR-GGSYSLRAVQMMIKPI 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 13/72 (18%)
FReD 245..421 CDD:294064 63/231 (27%)
ANGPTL1NP_001363692.1 PB1 74..138 CDD:383100 15/81 (19%)
FReD 275..490 CDD:238040 61/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.