DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and FCN3

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_003656.2 Gene:FCN3 / 8547 HGNCID:3625 Length:299 Species:Homo sapiens


Alignment Length:189 Identity:63/189 - (33%)
Similarity:92/189 - (48%) Gaps:27/189 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 VFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDLGGEFWLGLQKLHKMTTHRRMELYIQL 313
            ||.|:.:.|.||::.|||.|||.| ..:.|:...|.|:...|||||.:.||::|.....||.::|
Human   119 VFCDMDTEGGGWLVFQRRQDGSVDFFRSWSSYRAGFGNQESEFWLGNENLHQLTLQGNWELRVEL 183

  Fly   314 VDFDNASAYARYDNFVIGDEKQKYKLLSLGEYS-GNAGDAFRSHINHIIVGNPFAM-----ESSK 372
            .||:....:|.|..|.:..|...|: |:||::| |.|||:...|     .|.||..     :||.
Human   184 EDFNGNRTFAHYATFRLLGEVDHYQ-LALGKFSEGTAGDSLSLH-----SGRPFTTYDADHDSSN 242

  Fly   373 ----------WW--GTMNCNLNGKYRNSKVELDTTDGIWWGNWNVGNRYPLKSCKMLIR 419
                      ||  .....||||:|..|:...... ||.|.:.. |..:|.:..:|::|
Human   243 SNCAVIVHGAWWYASCYRSNLNGRYAVSEAAAHKY-GIDWASGR-GVGHPYRRVRMMLR 299

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 63/189 (33%)
FCN3NP_003656.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..81
FReD 90..299 CDD:238040 62/187 (33%)