DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and SMC1

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_116647.1 Gene:SMC1 / 850540 SGDID:S000001886 Length:1225 Species:Saccharomyces cerevisiae


Alignment Length:501 Identity:106/501 - (21%)
Similarity:194/501 - (38%) Gaps:163/501 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DQNNFSQNSRSSPDSSTENNSSSSDSEMEFVGTSA----------RGMLKH-----KKKDERKIS 54
            |:.:..|.|.|......||:.|..:|::..:.|..          |..:|:     :|:.:.||:
Yeast   697 DELSNGQRSNSIRAREVENSVSLLNSDIANLRTQVTQQKRSLDENRLEIKYHNDLIEKEIQPKIT 761

  Fly    55 ELTRKLAEAEINLKAQQEKGSILENCIKDKD--------DFIKTLQLSID---------LVTQTK 102
            ||.:||.:.| |.|         :|.:|:|:        :|...:..:|.         :..|:|
Yeast   762 ELKKKLDDLE-NTK---------DNLVKEKEALQNNIFKEFTSKIGFTIKEYENHSGELMRQQSK 816

  Fly   103 EMTIQKLQTQIMDLQSDL--DLSRITIKKNDGGNCAPAHDKVVKERKELNMENGKFREGNDQIVE 165
            |  :|:||.||:.:::.|  :..|::..:.       .::|..|:     :||.:        ||
Yeast   817 E--LQQLQKQILTVENKLQFETDRLSTTQR-------RYEKAQKD-----LENAQ--------VE 859

  Fly   166 IEKILNSK---EAEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVN--------- 218
            ::.:...:   |.:|..:|.|::|.|..:.:|:.....|..::....:||.:.|.|         
Yeast   860 MKSLEEQEYAIEMKIGSIESKLEEHKNHLDELQKKFVTKQSELNSSEDILEDMNSNLQVLKRERD 924

  Fly   219 --NKDHDEFVL-----LGSSKLPSIKLVTLPDFEPFAS--VFEDIPSAGRGWMIIQRRIDGSFDN 274
              .:|.::|.|     |.:.|:.:|.:       |.:|  ..:|:|.:             |.||
Yeast   925 GIKEDIEKFDLERVTALKNCKISNINI-------PISSETTIDDLPIS-------------STDN 969

  Fly   275 ATESNIITGCGDLGGEFWLGLQKLHK--MTTHRRMELYIQLVDFD--------NASAYARYDNF- 328
              |:..|:...|:.   :.||.|.:|  .|...|.||..::.:.:        ||.|..|||.. 
Yeast   970 --EAITISNSIDIN---YKGLPKKYKENNTDSARKELEQKIHEVEEILNELQPNARALERYDEAE 1029

  Fly   329 ----VIGDEKQKYK---------LLSL----GEYSGNAGDAFRSHINHI---IVGNPFAMESSKW 373
                ||.:|.::.|         .|.:    .|......|....|::.|   :..||        
Yeast  1030 GRFEVINNETEQLKAEEKKILNQFLKIKKKRKELFEKTFDYVSDHLDAIYRELTKNP-------- 1086

  Fly   374 WGTMNCNLNGKYRNSKVELDTTDGIWWGNWNVGNRY----PLKSCK 415
                |.|:.....|:.:.::..|    ..:|.|.:|    |||..|
Yeast  1087 ----NSNVELAGGNASLTIEDED----EPFNAGIKYHATPPLKRFK 1124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 12/68 (18%)
FReD 245..421 CDD:294064 46/208 (22%)
SMC1NP_116647.1 Smc 3..1225 CDD:224117 106/501 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.