DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and Fgl2

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_445907.2 Gene:Fgl2 / 84586 RGDID:620170 Length:429 Species:Rattus norvegicus


Alignment Length:418 Identity:118/418 - (28%)
Similarity:188/418 - (44%) Gaps:95/418 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 SELTRKLAEAEINLKAQQEKGSILENCIKDKDDFIKTLQLSIDLVTQTKEMTIQKLQTQIMDLQS 118
            |:...:|....:.|:..|:.|| :|..:|:    ::|||.::|.:         |...|...||:
  Rat    51 SQCPFQLTLPTLTLQLPQQFGS-MEEVLKE----VRTLQEAVDSL---------KKSCQDCKLQA 101

  Fly   119 DLDLSRITIKKNDGGNCAPAHDKVVKERKELNMENGKFREGNDQIVEIEKILNSKEAEIARLEFK 183
            |       ...:.|||.|.            ..|:.:.:|...|:.::...|.:.:.||..|:.:
  Rat   102 D-------EHPDPGGNGAE------------TAEDNRVQELESQVNKLSSELKNAKEEIQGLQGR 147

  Fly   184 IDESKLKIVQLEGAVKAKDEKIVKMTEILS------------EYNVNN-------KDHDEFVLLG 229
            ::  .|::|.:.......|.|:..:|.:::            |:|..|       ||..::.:||
  Rat   148 LE--SLQLVNMNNIENYVDNKVANLTSVVNSLDSKCFKCPSQEHNQPNPVQHLIYKDCSDYYVLG 210

  Fly   230 SSKLPSIKLVTLPD-----FEPFASVFEDIPSAGRGWMIIQRRIDGSFDNATE--SNIITGCGDL 287
            .....:.::.  ||     ||    |:.|:.:.|.||.::|.|:||| .|.|.  .:...|.|:|
  Rat   211 KRSSGTYRVT--PDHRNSSFE----VYCDMETTGGGWTVLQARLDGS-TNFTRGWKDYKAGFGNL 268

  Fly   288 GGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDA 352
            ..|||||..|:|.:|..:.|.|.|.|.||:..:.||.||.|.:.:|..||: |.||.|:|.||||
  Rat   269 EREFWLGNDKIHLLTKSKEMILRIDLEDFNGLTLYAVYDQFYVANEFLKYR-LHLGNYNGTAGDA 332

  Fly   353 --FRSHINHII--------------VGNPFAMESSKWW--GTMNCNLNGKYRNSKVELDTTDGIW 399
              |..|.||.:              .||.....||.||  ..::.||||||.:.:.: ...:||:
  Rat   333 LRFSRHYNHDLRFFTTPDRDNDRYPSGNCGLYYSSGWWFDACLSANLNGKYYHQRYK-GVRNGIF 396

  Fly   400 WGNW-------NVGNRYPLKSCKMLIRP 420
            ||.|       ..|.::..|..||:|||
  Rat   397 WGTWPGVSQAHPGGYKFSFKKAKMMIRP 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 12/65 (18%)
FReD 245..421 CDD:294064 75/203 (37%)
Fgl2NP_445907.2 ApoLp-III_like <71..177 CDD:304399 29/140 (21%)
Fibrinogen_C 199..425 CDD:278572 82/235 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.