DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and ANGPTL6

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_011526650.1 Gene:ANGPTL6 / 83854 HGNCID:23140 Length:537 Species:Homo sapiens


Alignment Length:401 Identity:90/401 - (22%)
Similarity:150/401 - (37%) Gaps:110/401 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 IQKLQTQIMDLQSDLDLSRITIKKNDGGNCAPAHD--------------KVVKERKELNMENGKF 156
            ::.|:.:...|.:.|...|..::...|....|..|              :|:....|......:|
Human   160 VRALRKESRGLSARLGQLRAQLQHEAGPGAGPGADLGAEPAAALALLGERVLNASAEAQRAAARF 224

  Fly   157 REGNDQIVEIEKILNSKEAEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKD 221
            .:.:.:..|:.:::..:.:.|||||           :|........::::....::....|.   
Human   225 HQLDVKFRELAQLVTQQSSLIARLE-----------RLCPGGAGGQQQVLPPPPLVPVVPVR--- 275

  Fly   222 HDEFVLLGSSKLPSIKLVTLPD---------FEPFAS---------------VFEDIPSA----- 257
                 |:||:...|..|...|:         .||.||               .::|...|     
Human   276 -----LVGSTSDTSRMLDPAPEPQRDQTQRQQEPMASPMPAGHPAVPTKPVGPWQDCAEARQAGH 335

  Fly   258 ------------------------GRGWMIIQRRIDGSFD-NATESNIITGCGDLGGEFWLGLQK 297
                                    |.||.:||||.|||.: ..|..:...|.|...||:||||:.
Human   336 EQSGVYELRVGRHVVSVWCEQQLEGGGWTVIQRRQDGSVNFFTTWQHYKAGFGRPDGEYWLGLEP 400

  Fly   298 LHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSHIN---- 358
            ::::|:....||.:.|.|:....|.|.||.|.:..|...|: |.||:|.|:|||:...|.:    
Human   401 VYQLTSRGDHELLVLLEDWGGRGARAHYDGFSLEPESDHYR-LRLGQYHGDAGDSLSWHNDKPFS 464

  Fly   359 ------HIIVGNPFAMESSKWW--GTMNCNLNGKYRN-----SKVELDTTDGIWWGNWNVGNRYP 410
                  ....||....:...||  ...:.||||.:.:     |:.:    ||::|..:. |..|.
Human   465 TVDRDRDSYSGNCALYQRGGWWYHACAHSNLNGVWHHGGHYRSRYQ----DGVYWAEFR-GGAYS 524

  Fly   411 LKSCKMLIRPM 421
            |:...|||||:
Human   525 LRKAAMLIRPL 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 9/65 (14%)
FReD 245..421 CDD:294064 65/237 (27%)
ANGPTL6XP_011526650.1 FReD 322..535 CDD:238040 61/218 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.