| Sequence 1: | NP_649170.1 | Gene: | CG7668 / 40190 | FlyBaseID: | FBgn0036929 | Length: | 422 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_112638.2 | Gene: | Fcna / 83517 | RGDID: | 621221 | Length: | 335 | Species: | Rattus norvegicus |
| Alignment Length: | 199 | Identity: | 70/199 - (35%) |
|---|---|---|---|
| Similarity: | 100/199 - (50%) | Gaps: | 25/199 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 239 VTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFDNATE-SNIITGCGDLGGEFWLGLQKLHKMT 302
Fly 303 THRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEY-SGNAGDAFRSHINHIIV---- 362
Fly 363 -------GNPFAMESSKWWGTMNC---NLNGKYRNSKVELDTTDGIWWGNW--NVGNRYPLKSCK 415
Fly 416 MLIR 419 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG7668 | NP_649170.1 | DUF16 | 146..>212 | CDD:279814 | |
| FReD | 245..421 | CDD:294064 | 67/193 (35%) | ||
| Fcna | NP_112638.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 47..114 | ||
| Collagen | <67..108 | CDD:396114 | |||
| FReD | 123..333 | CDD:238040 | 68/197 (35%) | ||
| A domain, contributes to trimerization. /evidence=ECO:0000250 | 123..162 | 7/20 (35%) | |||
| B domain, contributes to trimerization. /evidence=ECO:0000250 | 163..251 | 33/88 (38%) | |||
| Carbohydrate-binding. /evidence=ECO:0000250|UniProtKB:O00602 | 291..293 | 0/1 (0%) | |||
| P domain. /evidence=ECO:0000250|UniProtKB:O00602 | 326..335 | 4/8 (50%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 1 | 0.960 | - | - | ||
| 3 | 2.860 | |||||