DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and TNR

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_003276.3 Gene:TNR / 7143 HGNCID:11953 Length:1358 Species:Homo sapiens


Alignment Length:290 Identity:81/290 - (27%)
Similarity:131/290 - (45%) Gaps:48/290 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   165 EIEK-ILNSKEAEIARLEFKIDESKLKIVQLEGAVKAKDEKI------------VKMTEILSEYN 216
            |||. :|..|..:.:|.|..:|.....| :|||.::..|..:            :..|...:...
Human  1067 EIENYVLTYKSTDGSRKELIVDAEDTWI-RLEGLLENTDYTVLLQAAQDTTWSSITSTAFTTGGR 1130

  Fly   217 V--NNKDHDEFVLLGSSKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFDNATE-S 278
            |  :.:|..:.::.|.:......:....:......|:.|:.:.|.||::.|||.:|..|...: :
Human  1131 VFPHPQDCAQHLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWA 1195

  Fly   279 NIITGCGDLGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLG 343
            :...|.|::..||||||..:|::|:..|.||.:.:.|...| |:|.||.|.:.|.:..|| |.:|
Human  1196 DYRVGFGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEA-AFASYDRFSVEDSRNLYK-LRIG 1258

  Fly   344 EYSGNAGDAFRSHINHIIVGNPFAME---------------SSKWWGTMNC---NLNGKYRNSKV 390
            .|:|.|||:...|     .|.||:.|               ...|| ..||   ||||||..|: 
Human  1259 SYNGTAGDSLSYH-----QGRPFSTEDRDNDVAVTNCAMSYKGAWW-YKNCHRTNLNGKYGESR- 1316

  Fly   391 ELDTTDGIWWGNWNVGNRYPLKSCKMLIRP 420
               .:.||.|.:|. |:.:.:...:|.:||
Human  1317 ---HSQGINWYHWK-GHEFSIPFVEMKMRP 1342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 14/59 (24%)
FReD 245..421 CDD:294064 64/195 (33%)
TNRNP_003276.3 EGF_2 <208..230 CDD:285248
EGF_2 267..292 CDD:285248
EGF_2 299..323 CDD:285248
fn3 328..398 CDD:278470
fn3 416..496 CDD:278470
fn3 505..583 CDD:278470
FN3 595..679 CDD:238020
fn3 687..766 CDD:278470
fn3 776..855 CDD:278470
fn3 865..944 CDD:278470
fn3 954..1026 CDD:278470
FN3 1042..1127 CDD:238020 14/60 (23%)
FReD 1133..1342 CDD:238040 64/221 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.