DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and Angptl6

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_011240901.1 Gene:Angptl6 / 70726 MGIID:1917976 Length:474 Species:Mus musculus


Alignment Length:176 Identity:61/176 - (34%)
Similarity:83/176 - (47%) Gaps:16/176 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 GRGWMIIQRRIDGSFDNATE-SNIITGCGDLGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASA 321
            |.||.:||||.|||.:..|. .:...|.|...||:||||:.:|::|:....||.|.|.|:...:|
Mouse   297 GGGWTVIQRRQDGSVNFFTNWQHYKAGFGRPEGEYWLGLEPVHQVTSRGDHELLILLEDWGGRAA 361

  Fly   322 YARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSHIN----------HIIVGNPFAMESSKWW-- 374
            .|.||:|.:..|...|: |.||:|.|:|||:...|.:          ....||........||  
Mouse   362 RAHYDSFSLEPESDHYR-LRLGQYHGDAGDSLSWHNDKPFSTVDRDRDSYSGNCALYHRGGWWYH 425

  Fly   375 GTMNCNLNGK-YRNSKVELDTTDGIWWGNWNVGNRYPLKSCKMLIR 419
            ...:.||||. |..........||::|..:. |..|.||...||.|
Mouse   426 ACAHSNLNGVWYHGGHYRSRYQDGVYWAEFR-GGAYSLKKAVMLTR 470

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814
FReD 245..421 CDD:294064 61/176 (35%)
Angptl6XP_011240901.1 PRK09039 57..>154 CDD:181619
AMH_N <116..197 CDD:368070
FReD 259..470 CDD:238040 60/174 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.