DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and Angptl1

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001102853.1 Gene:Angptl1 / 679942 RGDID:1598128 Length:300 Species:Rattus norvegicus


Alignment Length:196 Identity:40/196 - (20%)
Similarity:82/196 - (41%) Gaps:35/196 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VGTSARGMLKHKKKDERKI------SELTRKLAEAEINLKAQQEKGSILENCIKDKDDFIKTLQL 93
            :|....|..|.||..:|:.      .|.|:|.:...: :..|:..|.|..|........||.:..
  Rat    17 IGHCKGGQFKIKKTTQRRYPRATDGKEETKKCSYTFL-VPEQKITGPICVNTKGQDAGTIKDMIT 80

  Fly    94 SIDLVTQTKEMTIQKLQTQIMDLQSDLDLSRITIKKNDGGNCAPAHDKVVKERKELNMENGKFRE 158
            .:||......::.||.:..::.|..|:|           ||       :|.|.|.|..|:   |.
  Rat    81 RMDLENLKDVLSRQKREIDVLQLVVDVD-----------GN-------IVNEVKLLRKES---RN 124

  Fly   159 GNDQIVE-----IEKILNSKE--AEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYN 216
            .|.::.:     :.:|:..::  .|:::||.||.....:::::....:..:.|...:|::::..:
  Rat   125 MNSRVTQLYMQLLHEIIRKRDNSLELSQLENKILNVTTEMLKMATRYRELEVKYASLTDLVNNQS 189

  Fly   217 V 217
            |
  Rat   190 V 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 13/72 (18%)
FReD 245..421 CDD:294064
Angptl1NP_001102853.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.