DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and fibcd1b

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:XP_005171959.1 Gene:fibcd1b / 567525 ZFINID:ZDB-GENE-070424-245 Length:492 Species:Danio rerio


Alignment Length:409 Identity:104/409 - (25%)
Similarity:171/409 - (41%) Gaps:79/409 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EINLKAQQEKGS-------ILENCIKDKDDFIKTLQLSIDLVTQTKEMTIQKLQTQIMDLQSDLD 121
            |.|.....|:|.       |..||.....:|::                ::.:||.::...:|.|
Zfish   103 EANALVTVERGDGSRINIFIDPNCPDYNSNFLR----------------LEGVQTSLLHSLTDHD 151

  Fly   122 LSRITIKKNDGG---NCAPAHDKVVKERKELNMENGKFREGNDQIVEIEKILNSKEAEIARLEFK 183
            ....::|..|..   |.|....|:.....:|.|:....|.|..   .:.:.||:.:.|.:||...
Zfish   152 TDLKSVKGQDRALLVNLAEEVAKLSAHAGQLKMDYESLRRGQS---NLGQDLNTLQTEQSRLIQL 213

  Fly   184 IDESKLKIVQL--------------EGAVKAKDEKIVKMTEI----LSEYNVNNKDHDEFVLLGS 230
            :.||::.:|::              .|.:||:.:..::...:    |......::..|...:..|
Zfish   214 LSESQINMVKVVNSVSDALNAMQKETGGLKARVKADLQRAPVRGVRLKGCANGSRPRDCSDIYAS 278

  Fly   231 SKLPSIKLVTLPDFEPFA-SVFEDIPSAGRGWMIIQRRIDGS------FDNATESNIITGCGDLG 288
            .:.........|...|.. .|:.|:.:.|.||.:||||.|||      :|:..|     |.|.:.
Zfish   279 GQREDGIYSVFPTHYPAGFQVYCDMSTDGGGWTVIQRREDGSVNFFREWDSYRE-----GFGKIT 338

  Fly   289 GEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIG----DEKQKYKLLSLGEYSGNA 349
            ||:||||:::|.::.....||.|.|.||:|::|:|:|..|.:|    |.:.....|::.:|:|.|
Zfish   339 GEYWLGLKQIHALSIQGNYELRIDLEDFENSTAFAQYGVFGVGLFSVDPEDDGYPLTIADYTGTA 403

  Fly   350 GDAFRSH----------INHIIVGNPFAMESSKWWGTMNC---NLNGKYRNSKVELDTTDGIWWG 401
            ||:...|          .|.....|..:.....|| ..||   ||||:|...: .....|||.|.
Zfish   404 GDSLLKHNGMKFTTKDRDNDHSENNCASFYHGAWW-YRNCHTSNLNGQYLRGQ-HTSYADGIEWS 466

  Fly   402 NWNVGNRYPLKSCKMLIRP 420
            :| .|.:|.||..:|.|||
Zfish   467 SW-TGWQYSLKFTEMKIRP 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 15/83 (18%)
FReD 245..421 CDD:294064 68/200 (34%)
fibcd1bXP_005171959.1 FReD 269..484 CDD:238040 69/222 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.