DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and CG30280

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_611641.6 Gene:CG30280 / 37522 FlyBaseID:FBgn0050280 Length:288 Species:Drosophila melanogaster


Alignment Length:273 Identity:81/273 - (29%)
Similarity:129/273 - (47%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 IEKILNSKEAEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHDEFVLLGS 230
            :|.|....|..::.|:    ||.|:: :..|.:....: ::..|..|:..::.|..|        
  Fly    31 LEAIYEQAENALSTLQ----ESLLQL-ETNGTLNTSPD-VIYPTSCLTSGDLENGLH-------- 81

  Fly   231 SKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGS---FDNATESNIITGCGDLGGEFW 292
                   .:.:|...|| .|:.:...||.||::||:|..|:   |.|..|..  .|.|:|..|::
  Fly    82 -------TLKVPGLSPF-QVYCENQLAGPGWIVIQKRFSGNLSFFRNWKEYK--NGFGNLMDEYF 136

  Fly   293 LGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSH- 356
            |||:|:..:|.....|||:.|.|||:...:|::|.|.||:|...|.:.:||:|||.|||:.||| 
  Fly   137 LGLEKIRALTALEPHELYVHLEDFDDTIKHAKFDEFAIGNEDDDYAMNTLGKYSGTAGDSLRSHR 201

  Fly   357 ----------INHIIVGNPFAMESSKWW--GTMNCNLNGKYR-NSKVELDT-TDGIWWGNWNVGN 407
                      .:|....|........||  ..::.||||:|. ..|.|... ..|:.|.:|. |:
  Fly   202 KMKFSTYDRDNDHEFNKNCAFYYLGGWWYNACLDSNLNGQYMPGGKYEESLFARGMCWRSWR-GH 265

  Fly   408 RYPLKSCKMLIRP 420
            .|..:..:|:|||
  Fly   266 NYGYRVTQMMIRP 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 9/45 (20%)
FReD 245..421 CDD:294064 68/194 (35%)
CG30280NP_611641.6 FReD 65..279 CDD:238040 73/233 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446505
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.