DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and Fga

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001008724.1 Gene:Fga / 361969 RGDID:2603 Length:782 Species:Rattus norvegicus


Alignment Length:496 Identity:119/496 - (23%)
Similarity:193/496 - (38%) Gaps:116/496 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 NFSQNSRSSPDSSTENNSSSSDSEMEFVGTSARGMLKHKKKDERKISEL-------TRKLAEAEI 65
            |:...:..|.|:.|....||..|       |..|.||....|..:.||.       |||      
  Rat   318 NWGSGTTGSDDTGTWGAGSSRPS-------SGSGNLKPSNPDWGEFSEFGGSSSPATRK------ 369

  Fly    66 NLKAQQEKGSILENCIKDKDDFIKTLQLSIDLVTQTKEMTIQK-----LQTQIMDLQSDLDLSRI 125
                :...|.:    :..|.|  |.|.:..:.||.|...|.::     :...::......::.:.
  Rat   370 ----EYHTGKL----VTSKGD--KELLIGNEKVTSTGTSTTRRSCSKTITKTVLGNDGHREVVKE 424

  Fly   126 TIKKNDGGNCAPAHD--------KVVKERKELNMENGKFREG------------------NDQIV 164
            .:..:||.:|....|        ..:.|...::.|.|.|.:.                  :|...
  Rat   425 VVTSDDGSDCGDGMDLGLTHSFSGRLDELSRMHPELGSFYDSRFGSLTSNFKEFGSKTSDSDIFT 489

  Fly   165 EIEKILN-----SKEAEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHDE 224
            :||...:     |..::.:.:..::.:| .|:.. |.|.:|..|...:.|:......:.:.| |.
  Rat   490 DIENPSSHVPEFSSSSKTSTVRKQVTKS-YKMAD-EAASEAHQEGDTRTTKRGRARTMRDCD-DV 551

  Fly   225 FVLLGSSKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDLG 288
            .....|.....|..:.||......||:.|..::..||::||:|:|||.: |.|..:...|.|.|.
  Rat   552 LQTHPSGAQNGIFSIKLPGSSKIFSVYCDQETSLGGWLLIQQRMDGSLNFNRTWQDYKRGFGSLN 616

  Fly   289 ----GEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNA 349
                ||||||...||.:|. |...|.::|.|:....|||.| :|.:|.|.:.| .|.:..|.|.|
  Rat   617 DKGEGEFWLGNDYLHLLTL-RGSVLRVELEDWAGKEAYAEY-HFRVGSEAEGY-ALQVSSYQGTA 678

  Fly   350 GDA-----------FRSHINHIIVGNPFAMESSKW-----------WGTMNC---NLNGKY---- 385
            |||           :.||.|  :..:.|..::.:|           |...:|   ||||.|    
  Rat   679 GDALMEGSVEEGTEYTSHSN--MQFSTFDRDADQWEENCAEVYGGGWWYNSCQAANLNGIYYPGG 741

  Fly   386 -----RNSKVELDTTDGIWWGNWNVGNRYPLKSCKMLIRPM 421
                 .||..|::  :|:.|..:. |..|.|::.:|.|||:
  Rat   742 TYDPRNNSPYEIE--NGVVWVPFR-GADYSLRAVRMKIRPL 779

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 14/88 (16%)
FReD 245..421 CDD:294064 67/214 (31%)
FgaNP_001008724.1 Fib_alpha 51..189 CDD:285864
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 264..374 17/72 (24%)
Fibrinogen_aC 388..453 CDD:288972 8/64 (13%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 522..542 5/20 (25%)
FReD 546..779 CDD:238040 73/241 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.