DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and CG8642

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_610396.2 Gene:CG8642 / 35845 FlyBaseID:FBgn0033312 Length:429 Species:Drosophila melanogaster


Alignment Length:410 Identity:123/410 - (30%)
Similarity:179/410 - (43%) Gaps:89/410 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 ISELTRKLAEAEINLKAQQEK-----------------GSILENC--IKDKDDFIKTLQLSIDLV 98
            ::.:..||||..|:    |.|                 |.|.|:.  ||||::.|..||..    
  Fly    50 VAPVPEKLAEVHID----QHKTIRISKGDLDDLLDVYMGKIAESAATIKDKENEINKLQTK---- 106

  Fly    99 TQTKEMTIQKLQ--TQIMDLQSDLDLSRITIKKNDGGNCAPAHDKVVKERKELNMENGKFREGND 161
            .||.:..::|.:  ||:...|..                  :....:||:.|      :.:|...
  Fly   107 DQTGDELLRKFENLTQVCSAQQS------------------SFTTAIKEKDE------QIKELEQ 147

  Fly   162 QIVEIEKILNSKEAEIARLEFKIDESKLKIVQLEGAVKAKDEKI-VKMTEILSEYNVNNKDHDEF 225
            ::...|..|..|:..:|.|......|.|.|..|:|.|...:.|. .|..::|:::.........|
  Fly   148 KVKVYETRLKRKQHVLAELRKLNGSSALLIEHLKGKVVYFERKFREKKDDLLADWEAATTSCVPF 212

  Fly   226 VLLGSSKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFDNATESNIIT-GCGDLGG 289
                 .:.|.|.|:.||.|.||....|...:||.||..||||:|||.:.....:..: |.|.|.|
  Fly   213 -----GRSPGIHLIHLPGFLPFLVPCEGQTAAGPGWTCIQRRLDGSVNFYRNWDAYSKGFGKLNG 272

  Fly   290 EFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFR 354
            ||::||:|||::|:.:..||||.:..|...::||.||:|:||.|::.|:|..||.|.|||.||.|
  Fly   273 EFFIGLEKLHRLTSSQPHELYISIRRFGGETSYAHYDDFLIGSEEEGYELKLLGHYQGNASDALR 337

  Fly   355 SH--------------INHIIVGNPFAMESSKWWGTM--NCNLNGKYRNSKVELDTTDGIWWGNW 403
            :|              ..|:   |........||...  ..||||:|  .|.|:|....|:|..|
  Fly   338 THDKMKFSTYDRDNDAFTHM---NCAEHHQGAWWYDFCSRSNLNGRY--FKGEVDNPQSIYWEPW 397

  Fly   404 NVGNRY---PLKSCKMLIRP 420
                 |   .|||.:|||||
  Fly   398 -----YSFRSLKSVQMLIRP 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 15/66 (23%)
FReD 245..421 CDD:294064 75/196 (38%)
CG8642NP_610396.2 GluZincin 72..>163 CDD:301352 23/118 (19%)
FReD 213..413 CDD:238040 81/210 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.