DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and CG9500

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:266 Identity:79/266 - (29%)
Similarity:117/266 - (43%) Gaps:44/266 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 QLEGAVKAKDE--KIVKMTEILSEYNVNN-------KDHDEFVLLG-SSKLPS----------IK 237
            |.:.|::.|.|  .:.|:...|.|.|.:|       |...:....| |.:.||          |.
  Fly    27 QNDTAIRNKPELKSLYKLVLALLEENQSNASTENIQKSSSDLNTTGLSGRYPSQCPTYPPAHGIY 91

  Fly   238 LVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGS---FDNATESNIITGCGDLGGEFWLGLQKLH 299
            .|.:...:|| .|..|...||.||.::.||....   |.:..|..  .|.|.|.|:|::||.|||
  Fly    92 TVQVLGLKPF-QVSCDAEIAGTGWTVMARRTSNKLNFFRSWAEYK--NGFGQLDGDFFIGLDKLH 153

  Fly   300 KMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSHINHIIVGN 364
            .:|..:..||||.|.||:..:.||.||...|..|.:.|.:..|||::|:|||:...:.|...  :
  Fly   154 AITKSQPHELYIHLEDFEGQTRYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNF--S 216

  Fly   365 PFAMESSKW-----------WGTMNC---NLNGKY-RNSKVELDTTDGIWWGNWNVGNRYPLKSC 414
            .|..::..|           |..:||   ||.|.| :..:.:.....||.|.:|.. ..|..|..
  Fly   217 TFDRDNDGWHKNCAEEYVGAWWHLNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRT-ESYSYKVM 280

  Fly   415 KMLIRP 420
            :|::||
  Fly   281 QMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 5/20 (25%)
FReD 245..421 CDD:294064 63/194 (32%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 67/217 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.