Sequence 1: | NP_649170.1 | Gene: | CG7668 / 40190 | FlyBaseID: | FBgn0036929 | Length: | 422 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016870167.1 | Gene: | TNC / 3371 | HGNCID: | 5318 | Length: | 2384 | Species: | Homo sapiens |
Alignment Length: | 217 | Identity: | 66/217 - (30%) |
---|---|---|---|
Similarity: | 104/217 - (47%) | Gaps: | 26/217 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 220 KDHDEFVLLGSSKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFDNATES--NIIT 282
Fly 283 GCGDLGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSG 347
Fly 348 NAGDAFRSH-----------INHIIVGNPFAMESSKWWGTMNC---NLNGKYRNSKVELDTTDGI 398
Fly 399 WWGNWNVGNRYPLKSCKMLIRP 420 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7668 | NP_649170.1 | DUF16 | 146..>212 | CDD:279814 | |
FReD | 245..421 | CDD:294064 | 61/192 (32%) | ||
TNC | XP_016870167.1 | EGF_2 | 377..403 | CDD:285248 | |
EGF_2 | 408..434 | CDD:285248 | |||
EGF_2 | 468..496 | CDD:285248 | |||
EGF_2 | 504..527 | CDD:285248 | |||
EGF_2 | 533..558 | CDD:285248 | |||
fn3 | 624..695 | CDD:306538 | |||
fn3 | 713..793 | CDD:306538 | |||
fn3 | 804..884 | CDD:306538 | |||
fn3 | 894..976 | CDD:306538 | |||
fn3 | 986..1064 | CDD:306538 | |||
fn3 | 1075..1154 | CDD:306538 | |||
fn3 | 1169..1241 | CDD:306538 | |||
fn3 | 1260..1327 | CDD:306538 | |||
fn3 | 1348..1427 | CDD:306538 | |||
fn3 | 1439..1508 | CDD:306538 | |||
fn3 | 1533..1605 | CDD:306538 | |||
fn3 | 1619..1691 | CDD:306538 | |||
fn3 | 1716..1788 | CDD:306538 | |||
fn3 | 1804..1883 | CDD:306538 | |||
fn3 | 1894..1973 | CDD:306538 | |||
fn3 | 1985..2055 | CDD:306538 | |||
fn3 | 2071..2143 | CDD:306538 | |||
Fibrinogen_C | 2163..2372 | CDD:278572 | 66/217 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG2579 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |