DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and CG1889

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_727376.2 Gene:CG1889 / 31928 FlyBaseID:FBgn0030164 Length:338 Species:Drosophila melanogaster


Alignment Length:282 Identity:83/282 - (29%)
Similarity:132/282 - (46%) Gaps:32/282 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   170 LNSKEAEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHD-EFVLL---GS 230
            :.|...|||.::.:|...:.::|.|..|..|....:.....:.|.:..::...| |..||   |:
  Fly    54 MQSLNNEIASVKEQIGSLQEQLVDLRRAGSAPVVGLASPNALASRFPFSHNSLDIEPQLLANGGA 118

  Fly   231 SKLP------------SIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIIT 282
            :.:|            .:::....:.||| .||.|......||.::..|.|||.| |...::...
  Fly   119 AAVPITPANCLKQQHGVVRIRPRSNVEPF-FVFCDQKVRNGGWTMVVNRYDGSEDFNRKWADYKI 182

  Fly   283 GCGDLGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSG 347
            |.|.|..||::||.|||::|:....||.:||.:......||.||:|.||.|.::|:|..||:|.|
  Fly   183 GFGPLTTEFFIGLDKLHQITSSDNYELLVQLQNRKQELRYALYDHFSIGSESEQYRLNVLGDYHG 247

  Fly   348 NAGDAFRSH----------INHIIVGNPFAMESSKWWGTMNCNLNGKY----RNSKVELDTTDGI 398
            :|.||.|.|          :|.....|..|.:|..:|...:|||...:    |..:.::|...||
  Fly   248 DAADALRDHTGKKFSTHDRVNDENEQNCAAQQSGAFWYGGSCNLTNPFGLYQRLLERDVDGFKGI 312

  Fly   399 WWGNWNVGNRYPLKSCKMLIRP 420
            .|..:..|.:..||..:|::||
  Fly   313 LWRGFLNGPKGSLKIVRMMVRP 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 9/41 (22%)
FReD 245..421 CDD:294064 67/191 (35%)
CG1889NP_727376.2 Lzipper-MIP1 <34..80 CDD:291087 7/25 (28%)
FReD 123..335 CDD:238040 67/213 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446499
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.