DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and CG1791

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_572591.1 Gene:CG1791 / 31927 FlyBaseID:FBgn0030163 Length:334 Species:Drosophila melanogaster


Alignment Length:292 Identity:86/292 - (29%)
Similarity:123/292 - (42%) Gaps:67/292 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 ARLEFKIDE---SKLKIVQLEGAV---KAKDEKIVKMTEIL--------------------SEYN 216
            ||::|..||   .|.::.:|:|.:   |.:...|...|.:|                    :..|
  Fly    59 ARVQFMTDELQNLKTELNELQGLIEEYKNQGTGIPIATRLLRPLPASVQTFPLALATPPDDTPRN 123

  Fly   217 VNNKDHDEFVLLGSSKLPSIKLVTLPDFEP-FASVFEDIPSAGRGWMIIQRRIDGSFD-NATESN 279
            ..::.|.:           :::...||.|| |||..:.:...  |||:|..|.|||.| |....|
  Fly   124 CYDEKHGQ-----------VRIRIAPDMEPFFASCDQKVRDG--GWMVIAYRFDGSEDFNKDWQN 175

  Fly   280 IITGCGDLGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGE 344
            ...|.|.|..||::||.|||::|.....||.|.:........:|.||:|.||.|.:||.|..||.
  Fly   176 YKAGFGALNSEFFIGLDKLHRLTNSEHHELLIIMKKKSGEERFALYDHFSIGSESEKYLLYVLGA 240

  Fly   345 YSGNAGDAFRSHINHIIVGNPFA---------------MESSKWWGTMNC---NLNGKYRNSKV- 390
            |.|:|||:.|.|     .|..|.               ..:..||....|   ||.|.:: ||. 
  Fly   241 YKGDAGDSLRYH-----AGKKFTTFDQDNDDNGQNCARTHAGAWWYGRECFESNLFGTFQ-SKYG 299

  Fly   391 -ELDTTDGIWWGNWNVGNRYPLKSCKMLIRPM 421
             |:....||.|.::..|....|...:|||||:
  Fly   300 QEIGYFKGILWKSFLPGPTGSLSYVRMLIRPL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 11/39 (28%)
FReD 245..421 CDD:294064 69/197 (35%)
CG1791NP_572591.1 FReD 119..331 CDD:238040 73/230 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446500
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.