DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and Angptl6

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001100172.1 Gene:Angptl6 / 298698 RGDID:1311141 Length:457 Species:Rattus norvegicus


Alignment Length:466 Identity:107/466 - (22%)
Similarity:179/466 - (38%) Gaps:108/466 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 SPDSST----ENNSSSSDSEMEFVGTSARGMLKHKKKDERKISELTRKLAEAEINLKAQQEKGSI 76
            ||..:|    .::.:|.|||:   .|....:.:|    |..:..|.|:.||           |..
  Rat    34 SPQMATSAVCRSSEASQDSEL---ATLRMRLGRH----EELLRALQRRAAE-----------GGA 80

  Fly    77 LENCIKDKDDFIKTLQLSIDLVTQTKEMTIQKLQTQIMDLQSDLDLSRITIKKNDGGNCAPA--- 138
            |...::      ...:.|:.|.|:..::..|..|    :..::.||         |...|.|   
  Rat    81 LAGEVR------ALREHSLTLNTRLGQLRAQLQQ----EAGAEPDL---------GAEPAAALGL 126

  Fly   139 -HDKVVKERKELNMENGKFREGNDQIVEIEKILNSKEAEIARLE-------------FKIDESKL 189
             .::.:....|......:.::..:|:.|..::::...:.:.||:             ..:....|
  Rat   127 LAERALGAEAEARRTTARLQQLEEQLREHAQLMSQHSSLLGRLQRACASPERGQQQVLPLPLVPL 191

  Fly   190 KIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHDEFVLLGSSKLPS--IKLVTLPDFEPF----- 247
            ..:.|.|:......::.::.|...|.::..:...      ||.||:  :.:.|.| ..|:     
  Rat   192 VPLSLVGSASNTSRRLDQIPEHQREQSLRQQGPP------SSPLPTGHVAVPTRP-VGPWRDCAE 249

  Fly   248 --------ASVFE------------DIPSAGRGWMIIQRRIDGSFDNATE-SNIITGCGDLGGEF 291
                    :.|:|            :....|.||.:||||.|||.:..|. .:...|.|...||:
  Rat   250 AQGAGHWQSGVYELRLGRRVVPVWCEQQQEGGGWTVIQRRQDGSVNFFTNWQHYKVGFGRPDGEY 314

  Fly   292 WLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAFRSH 356
            ||||:.:|::|:....||.|.|.|:....|.|.||:|.:..|...|: |.||:|.|:|||:...|
  Rat   315 WLGLEPVHQVTSRGDHELLILLKDWGGRGARAHYDSFSLEPESDHYR-LRLGQYHGDAGDSLSWH 378

  Fly   357 ----INHI------IVGNPFAMESSKWW--GTMNCNLNGK-YRNSKVELDTTDGIWWGNWNVGNR 408
                .|.:      ..||........||  ...:.||||. |..........||::|..:. |..
  Rat   379 SDKPFNTVDRDRDSYSGNCALYHRGGWWYHACAHSNLNGVWYHGGHYRSRYQDGVYWAEFR-GGA 442

  Fly   409 YPLKSCKMLIR 419
            |.||...||.|
  Rat   443 YSLKKAAMLTR 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 9/78 (12%)
FReD 245..421 CDD:294064 65/214 (30%)
Angptl6NP_001100172.1 Uso1_p115_C 66..>157 CDD:282695 19/120 (16%)
FReD 242..453 CDD:238040 64/212 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.