DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and ANGPT2

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_001138.1 Gene:ANGPT2 / 285 HGNCID:485 Length:496 Species:Homo sapiens


Alignment Length:476 Identity:120/476 - (25%)
Similarity:210/476 - (44%) Gaps:101/476 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 NSRSSPDSSTENNSSSSDSEMEFVGTSARGMLKHKKKDERKISELTRKLAEAE--INLKAQQEKG 74
            |.||| .|...:|:...|:.:|:..:..|..:.     |..:...|:.|.:.|  |....::|..
Human    52 NCRSS-SSPYVSNAVQRDAPLEYDDSVQRLQVL-----ENIMENNTQWLMKLENYIQDNMKKEMV 110

  Fly    75 SILENCIKDKDDFIKTLQLSIDLVTQTKEMT--IQKLQTQIMDLQSDLDLSRI--TIKKNDGGNC 135
            .|.:|.::::...:  :::..:|:.||.|.|  :..::.|:::..:.|:|..:  ::..|     
Human   111 EIQQNAVQNQTAVM--IEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTN----- 168

  Fly   136 APAHDKVVKERKELNMENGKFREGNDQIVEIEKILNSKEAEIARLE-FKIDESKLKIV--QLEGA 197
                 |:.|:..:...|..|.::.|..:.  :|:|..::..|.:|: .|.::.:|:::  :....
Human   169 -----KLEKQILDQTSEINKLQDKNSFLE--KKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSI 226

  Fly   198 VKAKDEKIVKMTEILSEYNVNN-----KDHD--EFV--LL------GSSKLPSIKLVTLPDFEPF 247
            ::..::|||..|       |||     :.||  |.|  ||      .|:|.|::.......|...
Human   227 IEELEKKIVTAT-------VNNSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDC 284

  Fly   248 ASVFE------------------------DIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDL 287
            |.||:                        |:.:.|.||.|||||.|||.| ..|......|.|:.
Human   285 AEVFKSGHTTNGIYTLTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNP 349

  Fly   288 GGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDA 352
            .||:|||.:.:.::|..:|..|.|.|.|::...||:.|::|.:..|:..|: :.|...:|.||..
Human   350 SGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYR-IHLKGLTGTAGKI 413

  Fly   353 FRSHINHIIVGNPFA---------------MESSKWWGTMNC---NLNGKYRNSKVELDTTDGIW 399
              |.|:.  .||.|:               |.:..||... |   ||||.|...:...:..:||.
Human   414 --SSISQ--PGNDFSTKDGDNDKCICKCSQMLTGGWWFDA-CGPSNLNGMYYPQRQNTNKFNGIK 473

  Fly   400 WGNWNVGNRYPLKSCKMLIRP 420
            |..|. |:.|.||:..|:|||
Human   474 WYYWK-GSGYSLKATTMMIRP 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 13/68 (19%)
FReD 245..421 CDD:294064 66/219 (30%)
ANGPT2NP_001138.1 SMC_N <78..>295 CDD:330553 49/242 (20%)
FBG 280..494 CDD:214548 67/221 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.