DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and ANGPTL3

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_055310.1 Gene:ANGPTL3 / 27329 HGNCID:491 Length:460 Species:Homo sapiens


Alignment Length:472 Identity:113/472 - (23%)
Similarity:194/472 - (41%) Gaps:94/472 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 DQNNFSQNSRSSPDSSTENNSSSSDSEMEFVGTSARGMLK---------HKKKDERKISELTRKL 60
            ||:|.|.:| .||:      ..|..:.::.|...|.|:|:         ||.|.:  |:::.:||
Human    20 DQDNSSFDS-LSPE------PKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQ--INDIFQKL 75

  Fly    61 -----------------AEAEINLKAQQEKGSILENCIKDKDDFIKTLQLSID----------LV 98
                             .|.|..|:....|       ::.|::.:|.:.|.::          ::
Human    76 NIFDQSFYDLSLQTSEIKEEEKELRRTTYK-------LQVKNEEVKNMSLELNSKLESLLEEKIL 133

  Fly    99 TQTKEMTIQKLQTQIMDLQSDLDLSRITIKKNDGGNCAPAHDKVVKERKELNMENGKFREGNDQI 163
            .|.|...:::..|.::..|.:                .|.|.:|...:..:..::...::....:
Human   134 LQQKVKYLEEQLTNLIQNQPE----------------TPEHPEVTSLKTFVEKQDNSIKDLLQTV 182

  Fly   164 VEIEKILNSKEAEIARLEFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHDEF--- 225
            .:..|.||.:.::|..:|.::..:.:: ...|.::.:| .:..:.|..|....:.|..||..   
Human   183 EDQYKQLNQQHSQIKEIENQLRRTSIQ-EPTEISLSSK-PRAPRTTPFLQLNEIRNVKHDGIPAE 245

  Fly   226 --VLLGSSKLPSIKLVTLPDFEPFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDL 287
              .:....:..|......|.......|:.|:.| |..|.:||.|||||.: |.|..|...|.|.|
Human   246 CTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVIS-GSPWTLIQHRIDGSQNFNETWENYKYGFGRL 309

  Fly   288 GGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDA 352
            .|||||||:|::.:.......|.|:|.|:.:...|..| :|.:|:.:..| .|.|...:||..:|
Human   310 DGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEY-SFYLGNHETNY-TLHLVAITGNVPNA 372

  Fly   353 FR-------SHINHIIVGNPFAME--SSKWWGTMNC---NLNGKYR--NSKVELDTTDGIWWGNW 403
            ..       |..:|...|:....|  |..||....|   ||||||.  .:|.:.:...|:.|.:.
Human   373 IPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQ 437

  Fly   404 NVGNRYPLKSCKMLIRP 420
            | |..|.:||.||||.|
Human   438 N-GRLYSIKSTKMLIHP 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 8/65 (12%)
FReD 245..421 CDD:294064 67/191 (35%)
ANGPTL3NP_055310.1 SMC_N <84..>215 CDD:330553 20/154 (13%)
FReD 243..453 CDD:238040 68/213 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR19143
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.