DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and Angptl2

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_036053.2 Gene:Angptl2 / 26360 MGIID:1347002 Length:493 Species:Mus musculus


Alignment Length:474 Identity:102/474 - (21%)
Similarity:194/474 - (40%) Gaps:71/474 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SSPDSSTENNSSSSDSEMEFVGTSARGMLKHKK-------KDERKISELTRKLAEAEINL--KAQ 70
            :.|::..|.....|..|..::....|......|       ..:|....:.....|.|::|  :..
Mouse    21 TGPEADVEGTEDGSQREYIYLNRYKRAGESPDKCTYTFIVPQQRVTGAICVNSKEPEVHLENRVH 85

  Fly    71 QEKGSILENCIKDKDDFIKTLQLSID----LVTQTK--EMTIQKLQTQIMDLQSDLDLSRITIKK 129
            :::..:|.|.:..:...|:|||..::    :|::.|  ....:.:.:::..|...| |..|..|:
Mouse    86 KQELELLNNELLKQKRQIETLQQLVEVDGGIVSEVKLLRKESRNMNSRVTQLYMQL-LHEIIRKR 149

  Fly   130 NDGGNCAPAHDKVVKERKELNMENGKFREGNDQIVEIEKILNSKEAEIARLEFKIDE--SKLKIV 192
            ::....:...::::.:..::.....|:::...:...:..:.:::...||:||.....  :...:.
Mouse   150 DNALELSQLENRILNQTADMLQLASKYKDLEHKFQHLAMLAHNQSEVIAQLEEHCQRVPAARPMP 214

  Fly   193 QLEGAVKAKDEKIVKMTEILSEYNVNNKDHDEFVLLGSSKLPSIKLVT----------------- 240
            |...|...:..:......|:::.:.|....|:.:.:....||::..:|                 
Mouse   215 QPPPAAPPRVYQPPTYNRIINQISTNEIQSDQNLKVLPPSLPTMPALTSLPSSTDKPSGPWRDCL 279

  Fly   241 --LPDFEPFASVFEDIP-SAGR-------------GWMIIQRRIDGS---FDNATESNIITGCGD 286
              |.|....:|::...| :..|             ||.:||||:|||   |.|  ......|.|:
Mouse   280 QALEDGHSTSSIYLVKPENTNRLMQVWCDQRHDPGGWTVIQRRLDGSVNFFRN--WETYKQGFGN 342

  Fly   287 LGGEFWLGLQKLHKMTTHRRMELYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGD 351
            :.||:||||:.::.:|.....:|.:.:.|:.....:|.|.:|.:..|.:.|| |.||.|.|||||
Mouse   343 IDGEYWLGLENIYWLTNQGNYKLLVTMEDWSGRKVFAEYASFRLEPESEYYK-LRLGRYHGNAGD 406

  Fly   352 AFRSH----------INHIIVGNPFAMESSKWW--GTMNCNLNGK-YRNSKVELDTTDGIWWGNW 403
            :|..|          .:.:..||....:...||  ...:.||||. ||.........||::|..:
Mouse   407 SFTWHNGKQFTTLDRDHDVYTGNCAHYQKGGWWYNACAHSNLNGVWYRGGHYRSRYQDGVYWAEF 471

  Fly   404 NVGNRYPLKSCKMLIRPMP 422
            . |..|.||...|:|||.|
Mouse   472 R-GGSYSLKKVVMMIRPNP 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 7/67 (10%)
FReD 245..421 CDD:294064 62/205 (30%)
Angptl2NP_036053.2 t_SNARE 156..>206 CDD:197699 5/49 (10%)
FReD 273..487 CDD:238040 63/217 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.