DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7668 and ANGPTL5

DIOPT Version :9

Sequence 1:NP_649170.1 Gene:CG7668 / 40190 FlyBaseID:FBgn0036929 Length:422 Species:Drosophila melanogaster
Sequence 2:NP_835228.2 Gene:ANGPTL5 / 253935 HGNCID:19705 Length:388 Species:Homo sapiens


Alignment Length:369 Identity:102/369 - (27%)
Similarity:142/369 - (38%) Gaps:100/369 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DLDLSRITIKKNDGGNCAPAHDKVVKERKEL---NMENGKFREGNDQIVEIEKILNSKEAEIARL 180
            |...|..|:.|.|.........|:.:|.|..   |::|              .|::...:....|
Human    48 DESKSNDTVCKEDCEESCDVKTKITREEKHFMCRNLQN--------------SIVSYTRSTKKLL 98

  Fly   181 EFKIDESKLKIVQLEGAVKAKDEKIVKMTEILSEYNVNNKDHDEFV----------------LLG 229
            ...:||.:..:..|...|.....:::.:|.     .|..|..|.|.                .:|
Human    99 RNMMDEQQASLDYLSNQVNELMNRVLLLTT-----EVFRKQLDPFPHRPVQSHGLDCTDIKDTIG 158

  Fly   230 S-SKLPSIKLVTLPDFE--PFASVFEDIPSAGRGWMIIQRRIDGSFD-NATESNIITGCGDLGGE 290
            | :|.||...:..|:..  || .|..|:...|.|..:||:||||..| .....:.:.|.|||.||
Human   159 SVTKTPSGLYIIHPEGSSYPF-EVMCDMDYRGGGRTVIQKRIDGIIDFQRLWCDYLDGFGDLLGE 222

  Fly   291 FWLGLQKLHKMTTHRRME--LYIQLVDFDNASAYARYDNFVIGDEKQKYKLLSLGEYSGNAGDAF 353
            |||||:|:..:...:...  ||:.|...|:..|||.||||.:.||.:.:| :.||.|||||||||
Human   223 FWLGLKKIFYIVNQKNTSFMLYVALESEDDTLAYASYDNFWLEDETRFFK-MHLGRYSGNAGDAF 286

  Fly   354 R-------------------------------------SHINHIIVGNPFAMESSKWWGTMNC-- 379
            |                                     ||:::          .:.||.. .|  
Human   287 RGLKKEDNQNAMPFSTSDVDNDGCRPACLVNGQSVKSCSHLHN----------KTGWWFN-ECGL 340

  Fly   380 -NLNGKYRNSKVELDTTDGIWWGNWNVGNR-YPLKSCKMLIRPM 421
             ||||.:..|...|.|  ||.||.|...|. ..:||..|.||.|
Human   341 ANLNGIHHFSGKLLAT--GIQWGTWTKNNSPVKIKSVSMKIRRM 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7668NP_649170.1 DUF16 146..>212 CDD:279814 10/68 (15%)
FReD 245..421 CDD:294064 74/221 (33%)
ANGPTL5NP_835228.2 FReD 146..382 CDD:238040 80/250 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.